Index

Safety: High trust score
Year Founded: 1999
Global Traffic Rank: 8,480
Estimated Worth: $1,935,360

Magyarország kezdőlapja: gyors hírek, feltárt tények, karcos vélemények. Fontos hírek: koronavírus, érettségi 2021



Domain summary

Last updated
2021-05-11
Domain label
index
Domain extension
hu
Domain registered:
1999-05-17
Domain updated:
2021-05-11
Global Traffic Rank
8,480
Statvoo Rating
B
Trust Score
High trust score
Estimated worth
$1,935,360
Estimated daily income
$1,792
Estimated monthly income
$54,507

Frequently Asked Questions (FAQ)

Q: When was Index.hu registered?
A: Index.hu was registered 22 years, 4 weeks, 2 days, 22 hours, 56 minutes, 48 seconds ago on Monday, May 17, 1999.
Q: When was the WHOIS for Index.hu last updated?
A: The WHOIS entry was last updated 1 month, 5 days, 22 hours, 56 minutes, 48 seconds ago on Tuesday, May 11, 2021.
Q: What are Index.hu's nameservers?
A: DNS for Index.hu is provided by the following nameservers:
  • ns.index.hu
Q: Who is the registrar for the Index.hu domain?
A: The domain has been registered at HUNIC.
Q: What is the traffic rank for Index.hu?
A: Index.hu ranks 8,480 globally on Alexa. Index.hu has a High trust score, and a Statvoo Rank of B.
Q: How many people visit Index.hu each day?
A: Index.hu receives approximately 223,979 visitors and 1,791,832 page impressions per day.
Q: What IP address does Index.hu resolve to?
A: Index.hu resolves to the IPv4 address 213.181.199.16.
Q: In what country are Index.hu servers located in?
A: Index.hu has servers located in the Hungary.
Q: What webserver software does Index.hu use?
A: Index.hu is powered by Nginx webserver.
Q: Who hosts Index.hu?
A: Index.hu is hosted by MAGEX Solutions Kft. in Hungary.
Q: How much is Index.hu worth?
A: Index.hu has an estimated worth of $1,935,360. An average daily income of approximately $1,792, which is roughly $54,507 per month.

Index.hu Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Index.hu Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Index.hu

H1 Headings

234 :
  1. Az Index népe szólt: megvan az ellenzéki favorit
  2. Itt a nagy összesítő, így állunk a vakcinaszállítmányokkal
  3. Kigyulladt egy lakás a Budaörsi úton, több embert kellett kimenteni
  4. Riasztást adott ki az egész országra a meteorológiai szolgálat
  5. Felfüggesztik az AstraZeneca használatát Szlovákiában
  6. Sokkoló felvételek a rakétatámadásokról
  7. Kikapott a United, bajnok a Manchester City
  8. Szakadó eső váltja a nyári meleget
  9. Magyarországra hárommilliónál is több Pfizer-vakcina érkezett
  10. Borít a hivatalnok, visszakéri a kenőpénzt a polgármestertől
  11. Elbúcsúztatták az athéni Olimpia magyar bajnokát
  12. Curtis testvére lehet a Katzenbach-gyilkosság egyik gyanúsítottja
  13. Elkészült a védettségi igazolvány telefonos applikációja
  14. Sorra fordulnak el kollégái a szexuális zaklatással vádolt James Francótól
  15. Sokan csak szabadulókártyának tekintik a védettségi igazolványt
  16. Ausztriában nyalókateszt jön az óvodásoknál
  17. Ötszáz alatt az új fertőzöttek száma
  18. Soroljuk, hová elég a védettségi igazolvány, ha nyaralni menne
  19. Hiába van beoltva, ha nincs igazolványa, nem mehet be
  20. Meghaladta a 4,3 milliót a beoltottak száma
  21. Menczer Tamás: A WHO szerint a kínai vakcina az időseket is védi
  22. Szijjártó Péter szerint az EU ne szórakozzon védettségi igazolvánnyal, inkább szerezzen vakcinát
  23. Tom Cruise visszaadja Golden Globe-díjait
  24. Hivatalos: Európában is ehető a lisztkukac
  25. Megszűnhet az önálló magyar színház Nagyváradon
  26. Hatalmas fegyverszállítmányra csapott le az amerikai haditengerészet
  27. Júniusban megújul a Rózsa utca
  28. 11 halottja van a kazanyi iskolánál történt lövöldözésnek
  29. További áldozatokat követeltek a rakétatámadások Izraelben
  30. Halálbüntetés várhat a szeretőjét meggyilkoló bokszolóra
  31. A francia kormányfő szerint szigorúbban kellene büntetni a rendőrök elleni erőszakot
  32. Megmérték, milyen mély az öt óceán
  33. Nem védett területen lőtte ki a medvét a liechtensteini herceg
  34. Itt az új paradicsom
  35. 85 éves szubrett lett a Nemzet Színésze
  36. Kezdhet aggódni, ha nincs még kész a strandteste
  37. Kádár Tamás a Szigetről: Mindenképp túl fogjuk élni
  38. Karácsony Gergely kéri az iskolákat, kezdődjön később az első óra
  39. Kórházba került Pápai Joci
  40. Kásler Miklós gratulált a székely petíció sikeréhez Pesty Lászlónak
  41. Világszerte lázadoznak az Apple-t használók
  42. Nem sikerült visszaszereznie az Esterházy-kincseket az Esterházy-alapítványnak
  43. Orbán Viktor részvétét fejezte ki a kazanyi mészárlásban meghalt áldozatok családjainak
  44. Medgyessy Péter: Jó ügy a Fudan, de a finanszírozás vállalhatatlan
  45. Megvan a tripla duplák új királya
  46. Philadelphiába igazolt a Budapest Honvéd futballistája
  47. Buffon távozik a Juventustól, de nem akar visszavonulni
  48. Kizárják a Juventust, ha nem lép vissza a Szuperligától
  49. Valter Attila megszerezte a fehér trikót a Giro d'Italia negyedik szakaszán
  50. Bánhidi Bence 2025-ig hosszabbított Szegeden
  51. Puzsér Róbert: Az HBO leszámolása Woody Allennel
  52. A SOTE-n lelket még nem műtenek
  53. Sorra halnak meg a medvék Romániában
  54. Ügyészségek vizsgálják Arthur kilövését
  55. 500 alá csökkent tavaly a közúti balesetek száma
  56. 40 milliós beruházásra készülnek a Heim Pál Gyermekkórházban
  57. Ritkán látható történelem
  58. túraddikt
  59. nyárspolgár
  60. Pangea
  61. Old Time R'N'R Magazine
  62. Rendszerváltó csibészek, akik kék tollal írtak történelmet
  63. Rendszerváltó csibészek, akik kék tollal írtak történelmet
  64. Gender és ember 2021-ben
  65. Elon Musk semmibe veszi a ható­ságokat
  66. Sült csirkecomb tocsnival és kukorica salátával
  67. Megbüntethet a rendőr azért, ha nincs a kocsiban láthatósági mellény
  68. Az amerikai lakókocsis kalandozás ne­hézségei
  69. 6 ok, amiért Az aranyembert látni és hallani is kell
  70. Jó lenne elolvasni, amit megosztunk
  71. Miért játszunk?
  72. 15+1 legjobb EU raktáras kínai cucc 5000 alatt - május
  73. Tényleg fontos az, hogy kövér vagy sovány egy politikus?
  74. Hétköznapi hunga­riz­mus avagy Matolcsy szin­tet lép
  75. Hogyan rombolja a NER a szállodapiacot és a szak­mát?
  76. Örüljünk-e a kínai vakcinának?
  77. Még több közélet
  78. Pofátlan átverés terjed a használtautó-piacon
  79. Meseházikó a Sagrada Familia tövében
  80. Ezek Csányi Vilmos etológus professzor legnagyobb áttörései
  81. Így világíts 0 Ft-os üzemeltetési költséggel
  82. A Harmadik Birodalom űrrepülőgépe
  83. Spárgás tarhonyasaláta
  84. „Nem izgalomra vá­gyom, csak az unalom egy másik verziójára”
  85. Ilyen volt egy 100 évvel ezelőtti menü
  86. „Ezt a menüt kóstoltam Rácz Jenő új éttermében“
  87. A legszebb kilátók Budapest közelében
  88. Horthyék tölgyei
  89. Te mi­lyen locsoló­csövet hasz­nálsz? Nézd meg ezt a 60 m-est!
  90. Annyira utálta Diana hercegnőt, hogy megvette a biciklijét
  91. Le tudnál érettségizni földrajzból? Kvíz!
  92. A Titanic életmentő magyar orvosa: a hős, aki sosem kapott állami kitüntetést
  93. Ezért utálod magad az összes rólad készült fotón
  94. 3 fontos dolog, ami segít elkerülni az anyai kiégést
  95. Guggolás vs. kitörés: melyik hatékonyabb?
  96. A történelem Darwin-díjasai: uralkodók, akik különösen bizarr módon lelték halálukat
  97. Nincs már meg a tűz, csak unatkozunk. Mit tegyünk?
  98. Virágóra: így olvashatod le a növényekről, mennyi az idő
  99. 3 remek erősítő gyakorlat a jobb futóteljesítményért
  100. ismered a népszerű kutyafajtákat? kvíz!
  101. Melyik hosszabb?
  102. Akkor fog tisztelni a gyereked, ha te is tiszteled őt
  103. Ilyen furán néz ki a sörfagyi
  104. Nem mindegy, mit mikor eszünk
  105. 7 trükk a sikeres fogyásért
  106. Találd ki, melyik magyar városban készült a kép?
  107. Ki volt Sherlock Holmes legjobb barátja?
  108. 10 dolog, amitől jó szerető leszel
  109. Minden, amit tudni akartál a szójáról
  110. Mit tanítanak az orkok járványkezelésről?
  111. Mit tanítanak az orkok járványkezelésről?
  112. Egy csomó élelmiszer ára emelkedik, ebből nagy baj lehet
  113. Még a mostani uniós elnökség alatt továbblépne az EU a magyar ügyben
  114. Az RTL Klub ledobta a bombát, meg is nyerte vele a nézőket
  115. Letarolják a 30 éves csopaki juharfasort
  116. Szereti a paradicsomot? Erről tudnia kell!
  117. 600 milliós magyar korrupciós botrány került a bíróságra
  118. Berlinből erősen kritizálják a magyar kormányt
  119. Egyszerűbb lesz a tartásdíj behajtásacsa
  120. Nagy változás jön a hazai kriptopiacon
  121. Gyakorlatilag eltűnt a magyar húzóágazat a statisztika szerint
  122. Változik az időjárás, ennek sokan nem fognak örülni
  123. Leváltják az eddigi rendszámokat Magyarországon
  124. Új adóintézkedéseket jelentett be Varga Mihály
  125. Brüsszel lesöpörte a magyar terveket, 3300 milliárd forint úszott el
  126. Veszélyes reakció indult Csernobilban, ami új atombalesettel fenyeget
  127. ///M, mint meghág!
  128. Mi a baj a hidrogénhajtással?
  129. Új, célszerű kisautót tervez Gordon Murray
  130. A Subaru is megvillantott egy villanyautót
  131. Megőrülsz a Matchboxokért? Itt a helyed!
  132. Oktató autó gázosítása
  133. Hatalmas fülkével jön az új DAF XF
  134. A járvány balekja a képviselő, aki otthoni háttérképpel próbálta elfedni, hogy épp vezet, de lebuktatta a biztonsági öv
  135. Gyártásba mehet az MG Cyberster
  136. Nagy veszteséggel zárult az elmúlt év a Nissan számára
  137. Motrac Unicorn, a szegény ember MV Agustája
  138. Ilyen lesz a Husqvarna elektromos robogója
  139. Észre sem vesszük, pedig milyen jó
  140. Megmutatták a következő Porsche Macan prototípusait
  141. Ez a Golf 16 évig épült, penge is lett
  142. Sok a kérdőjel az AstraZeneca oltásával kapcsolatban
  143. Adócsökkentéseket jelentett be a kormány, két szektor különadója is megszűnik
  144. Felkavaró felvételek kerültek ki a napokban felhevült izraeli-palesztin konfliktusról
  145. Nem elég a globális chiphiány, a merevlemezek ára is az egekbe szökhet egy új kriptodeviza miatt
  146. Már meghalni sem olcsó: brutálisan megdrágult a temetkezés Magyarországon
  147. Napelem és otthonfelújítási támogatás: fontos állásfoglalást tett az Államkincstár
  148. Fontos változás jön az utakon: 2022-től csak ilyen új autót engednek a forgalomba
  149. Külföldön is felfigyeltek a magyar törlesztési moratóriumra: hitelminősítői figyelmeztetés érkezett
  150. Hajmeresztő drágulást mértek a boltokban: ez kerül 30-45 százalékkal többe, mint tavaly ilyenkor
  151. Kiszivárgott: pár hét múlva jön az uniós digitális oltási igazolvány, ami leváltja a magyar védettségi igazolványt
  152. Kvíz: kinek a felesége volt Boleyn Anna? Történelmi kérdések a királyi viszonyokról
  153. Ettől olyan gyönyörű a japán nők bőre: a 4-2-4-es módszer ragyogóvá teszi az arcot
  154. Aktiválja a kollagéntermelést, feszesíti a kontúrokat: bőrfiatalítás infravörös lézersugárral
  155. Hogyan mondják a kutyák, hogy köszönöm? Ők is kimutatják a hálájukat
  156. Csokis-epres tortilla ropogósra sütve: 5 perc alatt kész a mennyei édesség
  157. Rottweiler fajtaleírás: a mészárosok kutyájából vált védelmező családtaggá
  158. 89 évesen is csodásan néz ki az Ének az esőben színésznője: ilyen Rita Moreno stílusa
  159. Új állatmenhely nyílik Újbudán: az állatkert nyújt szakmai segítséget
  160. Így marad sokáig életben a vágott virág: dupla annyi ideig lesz friss és üde
  161. Egy részlet a Dávid-szobron, ami leleplezte Michelangelo titkát
  162. Nem szerbek, nem horvátok, a bunyevác az bunyevác: de kik is ők?
  163. 10 épület a világból, amiről nehéz eldönteni, hogy szörnyű, vagy zseniális
  164. Ezek a nyár legdivatosabb frizurái: a frufru és a kócos fazon is hódít
  165. 8 laktató ebéd, ami segíti a fogyást: 500 kalóriásak, tele vannak rosttal
  166. 8 gyógyító étel makacs székrekedés ellen: segítik az emésztést
  167. Ezeknek a macskáknak nem átlagos a külseje: ettől olyan különlegesek
  168. Rántott csirkemell brokkolival töltve: kívül ropogós, belül szaftos lesz
  169. Ashley Grahamet nem zavarják a plusz kilók: fehérneműs fotó!
  170. A tészta a rohanós napok megmentője: mutatjuk, mivel lehet kínálni
  171. Masztektómián átesett nőknek készített melltartókat a Mango
  172. Selymes, tejszínes spárgakrémleves: burgonyától lesz laktató
  173. A fodros, csipkés és puffos ujjú blúzok a legnőiesebbek idén
  174. Megszületett Hódi Pamela babája: a kislány tiszta apja
  175. Együtt pihent az egykori álompár: fotók is készültek
  176. Ő Noszály Sándor 15 évvel fiatalabb párja, Orsi: fotók!
  177. Sikkes frizurák félhosszú hajból: frufruval is csinosak
  178. Christie Brinkley duci kislánya gyönyörű nő lett
  179. A leggagyibb számítógépes trükkök
  180. A 10 kedvenc Monty Python-jelenetünk
  181. Seth Rogen és James Franco nem dolgoznak többé együtt?
  182. 122 éve született minden idők legjobb táncosa, Fred Astaire
  183. Itt a Venom 2. - Vérontó előzetese!
  184. 50 idegesítő filmes klisé
  185. 25 éves a Port.hu
  186. A legjobb II. világháborús filmek - szerintünk
  187. Guy Ritchie és Jason Statham új filmje vezeti az amerikai mozik múlt heti bevételi listáját
  188. A 10 legnépszerűbb sorozat és film a Netflixen
  189. Összegyűjtöttük a legjobb filmeket a keddi tévézéshez
  190. Megnéztük, hogy teljesített A Konyhafőnök az Exatlonnal szemben
  191. Botrány és bojkott: vége a Golden Globe-nak?
  192. Joss Whedon megfenyegette Gal Gadot-t, hogy tönkreteszi a karrierjét
  193. Metzker Viktória Felsőtárkányban jakuzzizott, Kulcsár Edina megmutatta, hogy 11 kilót fogyott
  194. Bieberné általában akkor szokott ilyen szexin öltözni, ha a férje nincs ott
  195. Britney Spears megmutatta, mit viselt a 2000-es években
  196. Véletlenül adásba került egy reklám Gesztesi Károllyal, Young G-t a legrosszabbkor rúgták ki és más hírek
  197. John Travolta megható sorokkal emlékezett elhunyt feleségére
  198. Kántor mától két hétig Ferencvárosban nyomoz, irány a Madaras József tér!
  199. Még Christina Aguilerának is feltűnt, milyen jól utánozza ez a nő
  200. Sokakat Patrick Swayzere emlékeztet ez a kockahasú fazekas
  201. Jake Gyllenhaal ezzel a modellel vészelte át a karantént
  202. Otthagyta az egészségügyet, pucér modellként 22 nap alatt összejött az éves keresete
  203. 57 éves korában, rákban elhunyt Adele édesapja
  204. A kutyájával meztelenkedett a Született feleségek színésznője
  205. Ryan Reynolds azzal viccelt, Blake Livelyhoz fűződő szerelme egy reptéri szexszel kezdődött
  206. Norvégiából igazolna válogatott védőt a Ferencváros
  207. Eric Garcia megegyezett a Barcelonával
  208. Buffon elhagyja a Juventust - vissza is vonul?
  209. Mbappé az olimpián? – Lehetséges
  210. Az egyik legtehetségesebbnek tartott középpályására csapna le az Arsenal
  211. Lewandowski jól érzi magát Münchenben
  212. Kisvárda: távozik Supka Attila
  213. Nikolics hamarosan rekorder lehet!
  214. Grealish nem csak a United kívánságlistáján szerepel
  215. Meghatározó játékosok távoznak a Ferencvárostól!
  216. Csodaszép üdülők a Balaton déli partjáról
  217. Élj szeretteiddel együtt, mégis külön!
  218. Neked is lehet intim kerted, teraszod!
  219. Home office mediterrán hangulatban
  220. A bp-i használt megfeneklett, az új drágul
  221. Bukhatod a foglalót, ha nem figyelsz!
  222. 6 tipp, hogy megtaláld a legjobb ingatlanost!
  223. Megvalósult a balatoni álom!
  224. Teraszos lakások óriási árelőnnyel, a Rákos-pataknál!
  225. Tudatos pénzügyi döntésekkel már fiatalon lakásod lehet!
  226. Igen gyorsan épül ez Budán
  227. Az épített környezet szépségei
  228. Még bizonytalan a lakásépítések hosszú távú alakulása
  229. Angliai lakásokat épít a magyar fejlesztő
  230. Most belvárosi úrnő lehetsz!
  231. Luxus Angyalföldön
  232. Mézeskalács házikók között
  233. Prémium balatoni nyaralók!
  234. Elbújós házak kisvárosokból

H2 Headings

0 :

H3 Headings

42 :
  1. Gazdaság
  2. Kult
  3. Pol-komm
  4. Sport
  5. Tech-tud
  6. Rovataink a Facebookon
  7. JLo exét sokkolta, hogy az énekesnő ilyen hamar túllépett rajta
  8. Mindenki Bill Gates akar lenni a Tinderen
  9. Britney Spears hajszínt váltott
  10. Hosszú Katinka delfinekben gyönyörködött
  11. A nadrágja miatt magyarázkodik Gyurcsány Ferenc
  12. A Stranger Things Mike Wheelerje sok dolgot látott már, kolléganőjének mégis sikerült sokkolnia
  13. Adam Sandler visszatért az étterembe, ahonnan korábban elhajtották
  14. Kiss Ramóna elmesélte, hogyan jött össze a férjével
  15. Sosem lesz olyan menő, mint ez a hétéves kislány, aki matricát lő fel a Holdra
  16. Nem kapta meg az állást, mert bunkó volt a recepcióssal
  17. Tóth Andi most egy dalban szólt vissza Tóth Gabinak?
  18. Csokoládéból készítették el Picasso egyik leghíresebb művét
  19. Emma Roberts megmutatta a kisfia arcát
  20. Kirúgták a The Mandalorianból, a Disney most mégis Emmy-díjra jelöli
  21. Donatella Versace nagyon akart találkozni a Blurrel, de a Blue-t kapta helyette
  22. Mark Zuckerbergnek van egy Bitcoin nevű kecskéje
  23. Tigris portyázott Houstonban
  24. Vécélehúzó kölcsönbe
  25. Kim Kardashian elhagyta az egyik lábujját
  26. Lady Gaga stílusos módját választotta a távozásnak
  27. Covid-19 Világjárvány
  28. Tovább a Blog.hu Címlapra
  29. Tovább a címlapra
  30. Tovább a Napi.hu-ra
  31. Tovább a címlapra
  32. Tovább a Portfolio.hu-ra
  33. Tovább a Femina.hu-ra
  34. Tovább a címlapra
  35. Nem voltak jóban
  36. teri hatcher
  37. apa de vicces
  38. Tovább a Goal-ra
  39. Tovább az Otthontérkép.hu-ra
  40. Valutaváltó
  41. Menetrendek
  42. Mértékegységek, méretek

H4 Headings

7 :
  1. Budapest, XI. kerület Sasadi út 176.
  2. Budapest, IX. kerület Márton utca 10.
  3. Budapest, VIII. kerület Magdolna utca 38.
  4. Budapest, XIII. kerület Szobor utca 2.
  5. Eladó ingatlan, Budapest XI. kerület, Fehérvári út
  6. Eladó ingatlan, Csömör,
  7. Eladó ingatlan, Nagyigmánd, Fő utca

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

3 :

Total Images

95 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-181415-27

Links - Internal

46:

Links - Internal (nofollow)

0:

Links - Outbound

559:

Links - Outbound (nofollow)

0:

Keyword Cloud for Index.hu

klcsnft budapestma is tanultamnincskerletigazolvnynagy5adtanultamsosemnbkellmindekzben61grsz petrahapcvideezvalamitmegmutattam2eztnew7petraaz egyikm ft eladaztjtlleszn kutymelhunytvoltrkezettdocumentcreateelementscriptwindowiapzones windowiapzoneskutymeladelsszmapintrm ftemailshowwindowiapzonestovbbpintr klaudiakerltamerikaihiszedsborsmegtrtntbudapestprgycsaksportlekitmogatottaz0az amerikaiegyeuunisdollrbloghuft elad ingatlannfontosmelyikingatlantjoltruemintadatvdelmirajnha nincsvagyktanultam valamitmenegyikfelretiklfunctionmagyarjlsporthu4mozicmlapkszltvannakhasznlttovbb azpontosmagyarorszgonhogyklaudiaittilyenegyttvmgmsmiattsemvidekfilmokezrtbzsakibellelementtamsakarakkorlegjobbft eladki az3dvnyszerintaz n kutymgrszrjabmilyeneurindexszemlyi klcsntvm ft budapestaz jlettha azttnylegbotrnycmlaprategnapkonyhafnkwindowfbqtztbbhogyannextcjamesalattvantotalcarlehetkvztenemftvarelmindenjn azutcaastrazenecakszlm9mgiskattintsonmostolyanveshtenkoronaszemlyimitfemina8amicmlapjra windowiapzonesvdettsgiaz nazt hiszedmegautforintkalkultorcmlapjra windowiapzones windowiapzones2visszakzlettovbb a cmlapraha azt hiszedifellenrzttmirtktelad ingatlanmrnagyonsokingatlanezekmacmlapjravilgjrvnyt

Longtail Keyword Density for Index.hu

KeywordsOccurences
cmlapjra windowiapzones windowiapzones6
az n kutym4
tovbb a cmlapra4
m ft budapest4
ma is tanultam3
ha azt hiszed3
m ft elad3
ft elad ingatlan3
windowiapzones windowiapzones20
m ft7
grsz petra7
az egyik6
az j6
cmlapjra windowiapzones6
ki az4
pintr klaudia4
jn az4
ft budapest4
az n4
n kutym4
elad ingatlan3
ft elad3
tovbb az3
azt hiszed3
ha azt3
tanultam valamit3
az amerikai3
ha nincs3
szemlyi klcsn3
az107
windowiapzones40
s36
j29
egy28
tovbb28
nem28
hogy23
ha17
rja15
magyar15
ki15
var14
mg11
ez11
ves10
mr10
ft10
m10
cmlapjra10
meg9
egyik9
lehet9
budapest9
gy9
n8
tbb8
lesz8
ami8
ilyen7
t7
petra7
grsz7
lett7
m27
mozi7
nagyon7
legjobb7
van6
06
elad6
16
miatt6
csak6
itt6
fontos6
ok6
el6
cmlapra6
mit6
milyen6
egytt6
ma6
volt5
azt5
most5
adatvdelmi5
nincs5
vagy5
retikl5
akkor5
kerlet5
kvz5
szerint5
jn5
alatt5
sem5
utca5
function5
emailshow5
if5
vdettsgi5
vide5
25
sbors4
v4
ezt4
le4
klcsn4
kt4
nagy4
index4
ra4
korona4
windowfbq4
te4
kszl4
tnyleg4
aut4
kutym4
ezrt4
cmlap4
nextc4
james4
ad4
szma4
pintr4
sok4
klaudia4
tegnap4
fel4
mint4
vissza4
botrny3
magyarorszgon3
jl3
forint3
b3
melyik3
aki3
hiszed3
totalcar3
megtrtnt3
konyhafnk3
ms3
k3
dvny3
ezek3
mgis3
bloghu3
pr3
nb3
new3
szemlyi3
kalkultor3
sosem3
33
dollr3
ingatlan3
elhunyt3
ellenrztt3
porthu3
tv3
olyan3
men3
documentcreateelementscript3
true3
pc3
kzlet3
43
53
femina3
amerikai3
tl3
bell3
pontos3
hten3
astrazeneca3
rkezett3
vilgjrvny3
kattintson3
kerlt3
minden3
unis3
eu3
igazolvny3
tams3
kszlt3
mindekzben3
akar3
els3
valamit3
ingatlantjol3
film3
vannak3
tmogatott3
mirt3
eur3
kell3
63
hasznlt3
73
element3
sport3
megmutatta3
videk3
83
bzs3
93
tz3
tanultam3
hogyan3

Who hosts Index.hu?

Index.hu Hosting Provider Information

Hosted IP Address:213.181.199.16
Hosted Hostname:manis-2.mgxcdn.magex.hu
Service Provider:MAGEX Solutions Kft.
Hosted Country:HungaryHU
Location Latitude:47.4919
Location Longitude:19.05
Webserver Software:nginx

Is "MAGEX Solutions Kft." in the Top 10 Hosting Companies?

Name
Percentage
GOOGLE
17.1842%
AS-26496-GO-DADDY-COM-LLC
4.0884%
NAMECHEAP-NET
3.5315%
GoDaddy.com, LLC
2.6631%
AMAZON-AES
2.5761%
UNIFIEDLAYER-AS-1
2.1530%
Fara Negar Pardaz Khuzestan
1.9418%
Unknown
1.8112%
1&1 Internet AG
1.6678%
CONFLUENCE-NETWORK-INC
1.6554%
MAGEX Solutions Kft.
0.0000%

HTTP Header Analysis for Index.hu

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx
Date: Tue, 11 May 2021 23:16:08 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
X-Device-Type: desktop
Vary: X-Device-Type,Accept-Encoding
Content-Encoding: gzip
X-Choker: force-cache
X-Index-AreaCode: abroad
X-Cache-Status: BYPASS

Index.hu Domain Nameserver Information

HostIP AddressCountry
ns.index.hu 195.56.65.172Hungary Hungary


Need to find out who hosts Index.hu?


Domain Registration (WhoIs) information for Index.hu

 % Whois server 3.0 serving the hu ccTLD

domain: index.hu
record created: 1999-05-17 11:33:10
Tovabbi adatokert ld.:
https://www.domain.hu/domain-kereses/
For further data see:
https://www.domain.hu/domain-search/

Websites with Similar Names

Index-01.com
INDEX-01 - Increase Your Business Opportunities
Index-24.net
Welcome to nginx!
Index-able.com
index-able.com - This website is for sale! - index-able Resources and Information.
Index-acoustic.com
Index - Zvuková a akustická izolácia

Recently Updated Websites

Hayward20pmh.net (2 seconds ago.)E-audible.com (2 seconds ago.)Manureyboz.com (2 seconds ago.)Knoxvillemedicalcourier.com (4 seconds ago.)Firstlookinggood.com (5 seconds ago.)Missbossyfarm.com (5 seconds ago.)Daisyjoydesigns.com (6 seconds ago.)Rexleather.com (6 seconds ago.)Garagedoorservicescalgary.com (8 seconds ago.)Raulersonhospital.com (8 seconds ago.)Alatteknikindustri.com (9 seconds ago.)Mvp.kiwi (9 seconds ago.)Vivolutiontechnologies.com (12 seconds ago.)Arizonapoolfence.com (12 seconds ago.)Nurtured.net (13 seconds ago.)Foolproofpod.com (13 seconds ago.)Elephantcemetery.com (14 seconds ago.)Uscgearco.com (14 seconds ago.)Appawallet.com (15 seconds ago.)Premote.shop (16 seconds ago.)Ljmultiservices.com (16 seconds ago.)Mdsa.com (16 seconds ago.)Museen.org (16 seconds ago.)Spinalemuskelatrophie.com (17 seconds ago.)F5145.com (17 seconds ago.)Palo-holding.com (17 seconds ago.)Sunridgejanitorial.com (18 seconds ago.)Homesinhiltonheadarea.com (18 seconds ago.)Jailaid.com (18 seconds ago.)Americavscovid-19.com (19 seconds ago.)

Recently Searched Keywords

curbside pick up (1 second ago.)神乳 (1 second ago.)members1982538223avatarsdefaultavatargroup2398042282---size-5-small (1 second ago.)aov kriknak (2 seconds ago.)selectează opțiunile (9 seconds ago.)haz clic aquí (10 seconds ago.)seo services we follow new techniques and follow google search algorithm closely and based on it, we obtain techniques which bring results to our clients. (11 seconds ago.)дзеркало висувне smart з полицею світлий ясен... (12 seconds ago.)garde-corps en verre (13 seconds ago.)autumn harvest cookies (13 seconds ago.)附子理中丸 副作用 (14 seconds ago.)sereno (15 seconds ago.)industry-specific process consulting (16 seconds ago.)证书查询 (17 seconds ago.)klima sistemleri (18 seconds ago.)osseo (18 seconds ago.)color leggings (19 seconds ago.)shahdara (21 seconds ago.)elementor-nav-menu--main (22 seconds ago.)acesse o uol host (22 seconds ago.)b769c gi768 y (23 seconds ago.)irri (24 seconds ago.)sedona teledrama (25 seconds ago.)unduh formulir (26 seconds ago.)timetable meaning (27 seconds ago.)frozen vegetables (30 seconds ago.)derince ülkü ocaklari (31 seconds ago.)trng lao ng (32 seconds ago.)dla mediów (33 seconds ago.)store comics shorts (34 seconds ago.)