Indwell: Hope and Homes | Lives Transformed | Canadian Charity

Safety: Low trust score
Year Founded: 2021
Global Traffic Rank: Unknown
Estimated Worth: $9
Category: This site has not been categorized yet

You can be a part of ending homelessness. Help us create affordable housing communities that support people seeking health, wellness, and belonging.



Domain summary

Last updated
2021-04-17
Domain label
indwell
Domain extension
ca
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Frequently Asked Questions (FAQ)

Q: When was Indwell.ca registered?
A: Indwell.ca was registered 3 months, 2 weeks, 1 day, 22 hours, 47 minutes, 49 seconds ago on Saturday, April 17, 2021.
Q: When was the WHOIS for Indwell.ca last updated?
A: The WHOIS entry was last updated 3 months, 2 weeks, 1 day, 22 hours, 47 minutes, 49 seconds ago on Saturday, April 17, 2021.
Q: What are Indwell.ca's nameservers?
A: DNS for Indwell.ca is provided by the following nameservers:
  • ns15.domaincontrol.com
  • ns16.domaincontrol.com
Q: Who is the registrar for the Indwell.ca domain?
A: The domain has been registered at CIRA.
Q: What is the traffic rank for Indwell.ca?
A: Indwell.ca has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Indwell.ca each day?
A: Indwell.ca receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Indwell.ca resolve to?
A: Indwell.ca resolves to the IPv4 address 151.139.128.10.
Q: In what country are Indwell.ca servers located in?
A: Indwell.ca has servers located in the United States.
Q: What webserver software does Indwell.ca use?
A: Indwell.ca is powered by LiteSpeed webserver.
Q: Who hosts Indwell.ca?
A: Indwell.ca is hosted by HIGHWINDS3 in United States.
Q: How much is Indwell.ca worth?
A: Indwell.ca has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Indwell.ca Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Indwell.ca Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Indwell.ca

H1 Headings

0 :

H2 Headings

4 :
  1. News
  2. Making Housing Affordable
  3. Donate
  4. Get our emails

H3 Headings

7 :
  1. Hope & Homes For All
  2. DIGNITY
  3. LOVE
  4. HOPE
  5. A guide for facilitating partnerships with churches and charities to develop affordable housing
  6. Send a note of encouragement
  7. Send a message to our tenants

H4 Headings

0 :

H5 Headings

3 :
  1. Housing’s bottom line: Can passive house approach save long-term costs?
  2. Neighbours are building links—not walls—in Chatham-Kent
  3. ‘Best thing … in affordable housing in London’: $150M SoHo plan unveiled

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

18 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-87800250-1

Links - Internal

59:

Links - Internal (nofollow)

0:

Links - Outbound

17:

Links - Outbound (nofollow)

0:

Keyword Cloud for Indwell.ca

5fieldsarraytrueyounewsecondaryfill fill 5358a6483a027 mainstrokedarkenvalue1afd142 secondaryfillgformpostrendermonsterinsightsobjectsendevent83a027 mainstrokedarken strokevargformpostrender function varmainstroke stroke2stroke 5358a65358a6 mainfilldarkenhomesalldefaultsuaelparticlesscriptuaelparticlesurloptionsfunction varformidillustriocan5358a6hopefill 5358a6yoururl options61771d secondaryfilldarkenerstroke afd142 secondaryfill61771d mainstrokedarkenersecondarystroke strokedatestatefill 83a027 mainstrokedarkenservicesmade with illustrionew datevar uaelurlindwellafd142 secondaryfill fillstroke 61771d secondaryfilldarkenerislandsmainstrokedarken strokebind gformpostrenderscrolldistancefill afd142 mainstrokemainstrokedarkencommunitiesjquerycachedscriptillustrio mainfillmainstrokedarken stroke 83a027function documentnewsmainfilldarkenereventillustrio mainfill fillscopeaddresssecondaryfilldarken fill 393d73fill afd142ournull3affordable housing393d73 mainfilldarkener fillmainfilldarkener fillsecondarystrokedarkendepthifsowindowstroke 393d73 mainfilldarkenersupportivemainstrokedarkenerundefined typeoffunctionfill 393d73 secondarystrokedarkensecondarystrokestroke 282b51args61771d secondaryfilldarkener fillbindpreviousuaelurlsecondaryfilldarkener fill 282b51uaelurl uaelparticlesscriptuaelparticlesurl jquerycachedscriptfill 5358a6 secondarystrokecommunitymainfillsecondarystrokedarkener strokedonate61771d mainstrokedarkener strokemoretheyreturn393d73elemsdocument bindmainfilldarkenparseintdocheightmainfilldarken fillscroll depth83a027afd142 mainstroke strokehousingprogramsfutureeventnamesecondaryfilldarkener fillstroke 83a027 secondaryfilldarkendocumentdofill 282b51emailsecondarystrokedarken strokecheck83a027 secondaryfilldarken fillmainstrokedarkener strokesecondarystrokedarkenerfill 61771d mainstrokedarkenermainstroke stroke afd1420function document bindsecondaryfill fillsecondarystrokedarken stroke 393d73undefinedaffordablestroke afd142secondarystrokedarkener stroke 282b51labelafieldcustomidsecondaryfilldarkenerstroke 393d73fill 282b51 secondarystrokedarkenerscrolldistance timing61771dtenantstype83a027 secondaryfilldarkenhavemainfilldarkener fill 61771duaelparticlesscriptuaelparticlesurl jquerycachedscriptstroke 83a027fill 61771d5358a6 secondarystroke strokerepublicour tenantsurlmainstroketimingsecondarystroke stroke 5358a6afd142 mainstroke282b51 secondarystrokedarkener strokeafd142jquerybindscrolldepthweuaelurl uaelparticlesscriptuaelparticlesurlhousingcurrent282b51 secondarystrokedarkenerwindowbackend282b51stroke 5358a6 mainfilldarken393d73 secondarystrokedarken strokedemocratichousenowgformpostrender functionhousingcurrent programsfuturegetmainfilldarken fill 83a027cachemainstrokedarkener stroke 61771d393d73 mainfilldarkenerstrokefill 393d73mainfill fill afd142bind gformpostrender functionsecondaryfillpeopledatatypescrollsecondaryfilldarken filljquerycachedscript uaelurllovestroke 61771d5358a6 mainfilldarken filltypeofmainfill fillfillvar uaelurl uaelparticlesscriptuaelparticlesurldocument bind gformpostrendersecondaryfilldarkensendfill 83a027made393d73 secondarystrokedarken5358a6 secondarystroke

Longtail Keyword Density for Indwell.ca

KeywordsOccurences
made with illustrio3
61771d secondary-fill--darkener fill3
stroke 393d73 main-fill--darkener3
393d73 main-fill--darkener fill3
main-fill--darkener fill 61771d3
fill 61771d main-stroke--darkener3
61771d main-stroke--darkener stroke3
main-stroke--darkener stroke 61771d3
stroke 61771d secondary-fill--darkener3
secondary-fill--darkener fill 282b513
393d73 secondary-stroke--darken stroke3
fill 282b51 secondary-stroke--darkener3
282b51 secondary-stroke--darkener stroke3
secondary-stroke--darkener stroke 282b513
function document bind3
document bind gformpostrender3
bind gformpostrender function3
gformpostrender function var3
var uaelurl uaelparticlesscriptuaelparticlesurl3
secondary-stroke--darken stroke 393d733
fill 393d73 secondary-stroke--darken3
illustrio main-fill fill3
5358a6 secondary-stroke stroke3
main-fill fill afd1423
fill afd142 main-stroke3
afd142 main-stroke stroke3
main-stroke stroke afd1423
stroke afd142 secondary-fill3
afd142 secondary-fill fill3
secondary-fill fill 5358a63
fill 5358a6 secondary-stroke3
secondary-stroke stroke 5358a63
secondary-fill--darken fill 393d733
stroke 5358a6 main-fill--darken3
5358a6 main-fill--darken fill3
main-fill--darken fill 83a0273
fill 83a027 main-stroke--darken3
83a027 main-stroke--darken stroke3
main-stroke--darken stroke 83a0273
stroke 83a027 secondary-fill--darken3
83a027 secondary-fill--darken fill3
uaelurl uaelparticlesscriptuaelparticlesurl jquerycachedscript3
function var5
url options4
scroll depth4
affordable housing4
housingcurrent programsfuture3
stroke 282b513
61771d main-stroke--darkener3
main-stroke--darkener stroke3
stroke 61771d3
61771d secondary-fill--darkener3
secondary-fill--darkener fill3
fill 282b513
282b51 secondary-stroke--darkener3
secondary-stroke--darkener stroke3
bind gformpostrender3
function document3
document bind3
gformpostrender function3
our tenants3
new date3
scrolldistance timing3
undefined typeof3
var uaelurl3
uaelurl uaelparticlesscriptuaelparticlesurl3
uaelparticlesscriptuaelparticlesurl jquerycachedscript3
fill 61771d3
393d73 main-fill--darkener3
main-fill--darkener fill3
secondary-stroke stroke3
illustrio main-fill3
main-fill fill3
fill afd1423
afd142 main-stroke3
main-stroke stroke3
stroke afd1423
afd142 secondary-fill3
secondary-fill fill3
fill 5358a63
5358a6 secondary-stroke3
stroke 5358a63
stroke 393d733
5358a6 main-fill--darken3
main-fill--darken fill3
fill 83a0273
83a027 main-stroke--darken3
main-stroke--darken stroke3
stroke 83a0273
83a027 secondary-fill--darken3
secondary-fill--darken fill3
fill 393d733
393d73 secondary-stroke--darken3
secondary-stroke--darken stroke3
jquerycachedscript uaelurl3
var40
function26
if25
stroke18
fill18
016
return14
indwell13
options11
our11
undefined9
housing9
your8
we8
cache8
url8
17
they7
new7
true7
affordable6
previous6
window6
uaelurl6
jquery6
address6
islands6
tenants6
26
get6
61771d6
282b516
scroll6
afd1426
83a0276
hope6
393d736
5358a66
jquerycachedscript5
homes5
do5
love5
formid5
news5
typeof5
now5
eventname4
fieldsarray4
event4
scope4
timing4
state4
democratic4
type4
republic4
datatype4
scrolldistance4
depth4
afieldcustomid4
so4
document4
communities4
you4
community4
34
more4
have4
donate4
all4
people4
check3
illustrio3
made3
monsterinsightsobjectsendevent3
parseintdocheight3
43
args3
53
bindscrolldepth3
elems3
main-stroke3
windowbackend3
services3
house3
uaelparticlesscriptuaelparticlesurl3
main-fill3
label3
secondary-fill3
null3
gformpostrender3
programsfuture3
can3
supportive3
email3
value3
secondary-stroke--darkener3
defaults3
secondary-fill--darkener3
secondary-stroke3
main-stroke--darkener3
main-fill--darkener3
send3
secondary-stroke--darken3
secondary-fill--darken3
main-stroke--darken3
date3
main-fill--darken3
bind3
housingcurrent3

Who hosts Indwell.ca?

Indwell.ca Hosting Provider Information

Hosted IP Address:151.139.128.10
Hosted Hostname:map3.hwcdn.net
Service Provider:HIGHWINDS3
Hosted Country:United StatesUS
Location Latitude:37.751
Location Longitude:-97.822
Webserver Software:LiteSpeed

Is "HIGHWINDS3" in the Top 10 Hosting Companies?

Name
Percentage
GOOGLE
16.3509%
Unknown
7.9282%
AS-26496-GO-DADDY-COM-LLC
4.2120%
NAMECHEAP-NET
3.4686%
AMAZON-AES
2.5797%
GoDaddy.com, LLC
2.3421%
UNIFIEDLAYER-AS-1
2.2322%
Fara Negar Pardaz Khuzestan
1.8901%
CONFLUENCE-NETWORK-INC
1.6374%
1&1 Internet AG
1.5839%
HIGHWINDS3
0.0112%

HTTP Header Analysis for Indwell.ca

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Sat, 17 Apr 2021 15:55:04 GMT
Cache-Control: no-store, no-cache, must-revalidate
Content-Encoding: gzip
Content-Type: text/html; charset=UTF-8
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Pragma: no-cache
X-UA-Compatible: IE=edge
X-Pingback: https://indwell.ca/xmlrpc.php
Link:; rel=shortlink
Server: LiteSpeed
Alt-Svc: quic=":443"; ma=2592000; v="43,46", h3-Q043=":443"; ma=2592000, h3-Q046=":443"; ma=2592000, h3-Q050=":443"; ma=2592000, h3-25=":443"; ma=2592000, h3-27=":443"; ma=2592000
X-LiteSpeed-Cache: hit
X-HW: 1618674904.cds034.lo4.hn,1618674904.cds278.lo4.sc,1618674904.cds278.lo4.p
Access-Control-Allow-Origin: *
Connection: keep-alive
Content-Length: 54851

Indwell.ca Domain Nameserver Information

HostIP AddressCountry
ns15.domaincontrol.com 97.74.107.8
ns16.domaincontrol.com 173.201.75.8


Need to find out who hosts Indwell.ca?


Domain Registration (WhoIs) information for Indwell.ca

 Domain Name: indwell.ca
Registry Domain ID: D88457-CIRA
Registrar WHOIS Server: whois.ca.fury.ca
Registrar URL: ca.godaddy.com
Updated Date: 2016-01-06T18:18:19Z
Creation Date: 2001-11-08T21:56:51Z
Registry Expiry Date: 2023-11-08T05:00:00Z
Registrar: Go Daddy Domains Canada, Inc
Registrar IANA ID: not applicable
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Registry Registrant ID: 19423790-CIRA
Registrant Name: Homestead Christian Care Inc.
Registrant Organization:
Registrant Street: Unit A - 249 Caroline St. South
Registrant City: Hamilton
Registrant State/Province: ON
Registrant Postal Code: L8P3L6
Registrant Country: CA
Registrant Phone: +1.9055290454
Registrant Phone Ext:
Registrant Fax: +1.9055290355
Registrant Fax Ext:
Registrant Email: Login to show email
Admin ID: 25555186-CIRA
Admin Name: Jeff Neven
Admin Organization: Homestead Christian Care Inc.
Admin Street: Unit A - 249 Caroline St. South
Admin City: Hamilton
Admin State/Province: ON
Admin Postal Code: L8P3L6
Admin Country: CA
Admin Phone: +1.9055290454
Admin Phone Ext:
Admin Fax: +1.9055290355
Admin Fax Ext:
Admin Email: Login to show email
Tech ID: 25555483-CIRA
Tech Name: Jeff Neven
Tech Organization: Homestead Christian Care Inc.
Tech Street: Unit A - 249 Caroline St. South
Tech City: Hamilton
Tech State/Province: ON
Tech Postal Code: L8P3L6
Tech Country: CA
Tech Phone: +1.9055290454
Tech Phone Ext:
Tech Fax: +1.9055290355
Tech Fax Ext:
Tech Email: Login to show email
Billing ID:
Billing Name:
Billing Organization:
Billing Street:
Billing City:
Billing State/Province:
Billing Postal Code:
Billing Country:
Billing Phone:
Billing Phone Ext:
Billing Fax:
Billing Fax Ext:
Billing Email:
Name Server: ns15.domaincontrol.com
Name Server: ns16.domaincontrol.com
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of WHOIS database: 2021-04-17T15:55:05Z

Websites with Similar Names

Indwealth.com
PeachCap's Financial Services in Atlanta, GA | PeachCap
Indwebdev.com
indWebDev
Indwebster.com
indwebster.com
Indweek.com
indweek.com Is for Sale
Indwelcome.com
Coming Soon
Indwell.ca
Indwell: Hope and Homes | Lives Transformed | Canadian Charity
Indwell.com
Indwell: Hope and Homes | Lives Transformed | Canadian Charity
Indwell.in
Indwell

Recently Updated Websites

Mayale.com (5 seconds ago.)Nefdijital.com (9 seconds ago.)Bulistar.hu (9 seconds ago.)Kiinopoisk.com (13 seconds ago.)Lexicon.email (19 seconds ago.)Carolinavictoria.net (19 seconds ago.)Flooringsupplyus.com (19 seconds ago.)Identifilifestyle.com (24 seconds ago.)Soundbridgeacademy.com (28 seconds ago.)Drugli.com (28 seconds ago.)Stordalen.shop (28 seconds ago.)Naturandes.com (30 seconds ago.)Colerae.info (31 seconds ago.)Runtheparks.com (33 seconds ago.)Wreelreaders.org (35 seconds ago.)Cpasbien.online (35 seconds ago.)Nuconcorp.com (42 seconds ago.)Sailinginsanity.com (43 seconds ago.)Allthebestcannabis.us (43 seconds ago.)Figure8pro.com (45 seconds ago.)Domainlioness.com (46 seconds ago.)Kikigildar.com (47 seconds ago.)Indwef.com (49 seconds ago.)Spectrumcarnival.com (52 seconds ago.)Comfortliving.co.il (54 seconds ago.)Erezept-apotheke-wiesbaden.com (57 seconds ago.)Watermanandward.com (57 seconds ago.)Nonetheless.solutions (59 seconds ago.)Suzuon.com (1 minute 2 seconds ago.)Quartz-seq.com (1 minute 3 seconds ago.)

Recently Searched Keywords

microfinance software in nepal (1 second ago.)httpswwwvoleybabacom (3 seconds ago.)199 0 0b72a1 (7 seconds ago.)kuru elek (7 seconds ago.)--contentpaddingleft0px--contentpaddingright0px--contentpaddingtop0px--contentpaddingbottom0px--height181px--width181px (8 seconds ago.)importanteg-foundation-facts-dark-containerborder2px (8 seconds ago.)eventstatus httpsschemaorgeventscheduled eventattendancemode (9 seconds ago.)medical journal database (9 seconds ago.)линчи финанси (10 seconds ago.)china players (11 seconds ago.)成套资源> (14 seconds ago.)technologies supporting (14 seconds ago.)importanteg-home-video-wrapper esg-cctop35 (14 seconds ago.)shiftoffproblem (15 seconds ago.)vitamin b12 deficiency: what you need to know (16 seconds ago.)bitshare (17 seconds ago.)united arab emirates players (17 seconds ago.)fashion fitness (18 seconds ago.)homes247 careers (19 seconds ago.)histories of capitalism and the environment (20 seconds ago.)view membership information (20 seconds ago.)sammenlign pris (21 seconds ago.)twine thread (22 seconds ago.)table lamps (22 seconds ago.)超美人妖 (22 seconds ago.)sophisticated seconds (23 seconds ago.)0 none (25 seconds ago.)funeral planning (26 seconds ago.)garena download (26 seconds ago.)explore   (26 seconds ago.)