InfraMatch.nl: tijd voor je nieuwe baan als infra-professional

Safety: Low trust score
Year Founded: 2020
Global Traffic Rank: Unknown
Estimated Worth: $9
Last updated:2020-10-31
Category: This site has not been categorized yet

Bekijk hier actuele vacatures in de infrabranche: van werkvoorbereider tot beleidsmaker, van ondergrondse infrastructuur tot offshore energieparken.


Domain summary

Domain label
inframatch
Domain extension
nl
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is inframatch.nl ranked relative to other sites:

Percentage of visits to inframatch.nl from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Inframatch.nl registered?
A: Inframatch.nl was registered 2 months, 4 weeks, 12 hours, 43 minutes, 20 seconds ago on Saturday, October 31, 2020.
Q: When was the WHOIS for Inframatch.nl last updated?
A: The WHOIS entry was last updated 2 months, 4 weeks, 12 hours, 43 minutes, 20 seconds ago on Saturday, October 31, 2020.
Q: What are Inframatch.nl's nameservers?
A: DNS for Inframatch.nl is provided by the following nameservers:
  • ns2.transip.eu
  • ns0.transip.net
  • ns1.transip.nl
Q: Who is the registrar for the Inframatch.nl domain?
A: The domain has been registered at Stichting Internet Domeinregistratie NL.
Q: What is the traffic rank for Inframatch.nl?
A: Inframatch.nl has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Inframatch.nl each day?
A: Inframatch.nl receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Inframatch.nl resolve to?
A: Inframatch.nl resolves to the IPv4 address 141.138.138.209.
Q: In what country are Inframatch.nl servers located in?
A: Inframatch.nl has servers located in the Netherlands.
Q: What webserver software does Inframatch.nl use?
A: Inframatch.nl is powered by Nginx webserver.
Q: Who hosts Inframatch.nl?
A: Inframatch.nl is hosted by TransIP B.V. in Netherlands.
Q: How much is Inframatch.nl worth?
A: Inframatch.nl has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Inframatch.nl Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Inframatch.nl Free SEO Report

Website Inpage Analysis for Inframatch.nl

H1 Headings

0 :

H2 Headings

1 :
  1. Footer

H3 Headings

4 :
  1. Vacatures in het werkveld
  2. Vacatures per provincie
  3. Vacatures per organisatietype
  4. Vacature-updates via mail

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

2 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-4212636-28

Links - Internal

19:

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Inframatch.nl

textalign0borderinfra hidden labelplanologieomfffcontentwpmchimpaitemheightfiltersselecttopwidthposition absolute1technici3pxposition relativecenterwpmchimpaw1label hiddennone wpmchimpaw1padding 0textalign centerondergrondsewebuttonwpmchimparesetvoor technicipointerevents nonenorepeat centerwpmchimpaw1van35pxhidden labelcultuurtechniekheight 35pxvacatures voor technicirevinitrevslider11offshorewpmchimpaw1 wpmchimpaitempointereventswebkitanimationdelaygeotechniektop 0tenorepeat centervacatures voorpaddingleft 35pxinputiconabsolute0 pointereventswpmchimpaw1wegenbouwvoormargin0 left 0ondergrondse infratechniekoncerevslider11label0 pointerevents nonesoliddisplay inlineblockcentercivieleleftvarwpmchimpaw1sp8margin 00paddingwidth 100wpmchimpataghetbackgroundcolorwpmchimpafieldcolorjepaddinghiddenlineheightinframatchleft 0blockoverauto wpmchimpaw1divnorepeatdisplayinputlabelbodemborderradiustop 0 left5pxinfra hidden10pxwebkittransformbackgroundinputtypetextautowpmchimpaw1 formbox12pxerr16pxwpmcshakedisplay none wpmchimpaw120pxborderinlineblockwpmchimpaw1 wpmcficondisplay noneleft wpmchimpaw1positionhidden label hidden1pxwpmchimpaw1signalshowlabel hidden labelerr errverkeerskundewpmcficonfontsize 10pxscale05relativetextalign leftnonewpmchimparesetnonepaddingleftsp8width 35pxciviele techniek40pxwpmchimpaw1 wpmchimpatagformboxvacatures0 leftdisplay blocktransformfontsizespanafterspanbeforeinfra0inputicon background

Longtail Keyword Density for Inframatch.nl

KeywordsOccurences
hidden label hidden4
label hidden label4
infra hidden label4
display none wpmchimpaw-14
0 pointer-events none4
vacatures voor technici3
top 0 left3
0 left 03
hidden label58
wpmchimpaw-1 wpmchimpa-item8
position absolute6
none wpmchimpaw-16
civiele techniek5
pointer-events none5
top 05
height 35px5
display none5
position relative4
0 pointer-events4
left 04
display block4
wpmchimpaw-1 wpmc-ficon4
vacatures voor4
infra hidden4
auto wpmchimpaw-14
width 1004
text-align center4
label hidden4
ondergrondse infra4
wpmchimpaw-1 wpmchimpa-tag3
font-size 10px3
display inline-block3
no-repeat center3
no-repeat centerwpmchimpaw-13
inputicon background3
left wpmchimpaw-13
padding-left 35px3
text-align left3
0 left3
voor technici3
padding 03
width 35px3
margin 03
wpmchimpaw-1 formbox3
err err3
label59
hidden58
wpmchimpaw-150
024
width13
display13
left12
35px12
height12
margin11
position10
none10
top10
10px9
err9
-webkit-transform8
18
transform8
vacatures8
line-height8
wpmchimpa-item8
color8
background8
text-align8
font-size8
auto7
center7
infra7
voor6
border-radius6
sp86
background-color6
no-repeat6
absolute6
inframatch6
wpmc-ficon6
block5
pointer-events5
12px5
content5
je5
inputicon5
3px5
inputtypetext5
20px5
techniek5
civiele5
spanbefore4
van4
ondergrondse4
var4
fff4
relative4
oncerevslider114
5px4
16px4
nonewpmchimpa-reset4
wpmchimpaw-1sp84
-webkit-animation-delay4
wpmcshake4
bodem3
inline-block3
cultuurtechniek3
div3
40px3
spanafter3
filters3
wpmchimpaw-1signalshow3
scale053
wpmchimpa-tag3
we3
om3
solid3
padding-left3
1px3
revinitrevslider113
padding3
border3
select3
formbox3
0border3
0padding3
buttonwpmchimpa-reset3
wpmchimpa-field3
over3
centerwpmchimpaw-13
het3
technici3
wegenbouw3
verkeerskunde3
planologie3
offshore3
inputlabel3
geotechniek3
te3

Who hosts Inframatch.nl?

Inframatch.nl Hosting Provider Information

Hosted IP Address:141.138.138.209
Hosted Hostname:jobtec.nl
Service Provider:TransIP B.V.
Hosted Country:NetherlandsNL
Location Latitude:52.3824
Location Longitude:4.8995
Webserver Software:nginx

Is "TransIP B.V." in the Top 10 Hosting Companies?

Name
Percentage
GoDaddy.com, LLC
9.5100%
DoD Network Information Center
8.4509%
Google Inc.
2.8338%
Confluence Networks Inc
2.6217%
Amazon.com, Inc.
2.1737%
Namecheap, Inc.
2.1384%
TOT Public Company Limited
1.5665%
1&1 Internet AG
1.5512%
Merit Network Inc.
1.3856%
Unified Layer
1.3043%
TransIP B.V.
0.0746%

HTTP Header Analysis for Inframatch.nl

Http-Version: 1.1
Status-Code: 301
Status: 301 Moved Permanently
Server: nginx
Date: Sat, 31 Oct 2020 20:11:16 GMT
Content-Type: text/html; charset=iso-8859-1
Content-Length: 230
Connection: keep-alive
X-Frame-Options: https://apps.jobtec.nl
Location: https://inframatch.nl/
X-Powered-By: PleskLin

Inframatch.nl Domain Nameserver Information

HostIP AddressCountry
ns2.transip.eu 37.97.199.195
ns0.transip.net 195.135.195.195
ns1.transip.nl 195.8.195.195


Need to find out who hosts Inframatch.nl?


Domain Registration (WhoIs) information for Inframatch.nl

 Domain name: inframatch.nl
Status: active

Registrar:
TransIP Group
Vondellaan 47
2332AA LEIDEN
Netherlands

Abuse Login to show email
Date: 1998-02-13

Updated Date: 2018-11-28

DNSSEC: yes

Domain nameservers:
ns2.transip.eu
ns0.transip.net
ns1.transip.nl

Record maintained by: NL Domain Registry

Copyright notice
No part of this publication may be reproduced, published, stored in a
retrieval system, or transmitted, in any form or by any means,
electronic, mechanical, recording, or otherwise, without prior
permission of the Foundation for Internet Domain Registration in the
Netherlands (SIDN).
These restrictions apply equally to registrars, except in that
reproductions and publications are permitted insofar as they are
reasonable, necessary and solely in the context of the registration
activities referred to in the General Terms and Conditions for .nl
Registrars.
Any use of this material for advertising, targeting commercial offers or
similar activities is explicitly forbidden and liable to result in legal
action. Anyone who is aware or suspects that such activities are taking
place is asked to inform the Foundation for Internet Domain Registration
in the Netherlands.
(c) The Foundation for Internet Domain Registration in the Netherlands
(SIDN) Dutch Copyright Act, protection of authors' rights (Section 10,
subsection 1, clause 1).

Websites with Similar Names

Infra-architects.info
geregistreerd via Argeweb
Infra-architects.org
geregistreerd via Argeweb
Infra-asia.net
Error 404 (Not Found)!!1
Infra-azure.com
INFRA-AZURE LABS – Home of Lunabar, the Digital Lunar Almanack
Infra-azza.com
403 Forbidden
Infra-beton.ro
Infra-Beton - Prefabricate din Beton, Conducte Beton si Camine Beton
Infra-blog.com
ふらログ
Infra-build.com
GESTIB - Connexion

Recently Updated Websites

Illuminateexecutive.com (2 seconds ago.)Micharlem.com (4 seconds ago.)Integreodonto.com (4 seconds ago.)Iheartallrentals.com (7 seconds ago.)Hr4gov.com (9 seconds ago.)Ibuyhousesinhouston.com (9 seconds ago.)Hotelfurnishingsltd.com (11 seconds ago.)Homestretchbrew.com (13 seconds ago.)Heart-hr.com (15 seconds ago.)Partyvision.store (15 seconds ago.)Go-mutualism.com (17 seconds ago.)Homietrailer.com (19 seconds ago.)Imd-edu.com (20 seconds ago.)Groples.com (21 seconds ago.)Idemandfitness.com (26 seconds ago.)Htbamerica.com (26 seconds ago.)Forgedalignment.com (28 seconds ago.)Honestvisionrealty.com (28 seconds ago.)Hybridbatteryaustin.com (28 seconds ago.)Hi-freelancer.com (31 seconds ago.)Homeontherangeland.com (32 seconds ago.)In-my-own-lane.com (32 seconds ago.)Herostandgames.com (34 seconds ago.)Hudsonvalleymatterport.com (35 seconds ago.)Ictbanna.com (35 seconds ago.)Highhillhomes.com (36 seconds ago.)Hempzillavapes.com (37 seconds ago.)Herflawlesswinks.com (38 seconds ago.)Httpswwwlakeelsinoregym.com (42 seconds ago.)Hometowncarwashes.com (44 seconds ago.)

Recently Searched Keywords

新站提交 (1 second ago.)pulvitec (2 seconds ago.)15px 10px (3 seconds ago.)paladin (3 seconds ago.)2020 updated (4 seconds ago.)野狼导航 (4 seconds ago.)483-1807 fax 1 (7 seconds ago.)leahchashop (8 seconds ago.)confirmed cases (9 seconds ago.)hope you (10 seconds ago.)ktry (13 seconds ago.)mir (15 seconds ago.)外星大袭击 (18 seconds ago.)all border-radius 100px (21 seconds ago.)khc bia b (21 seconds ago.)˫�� (22 seconds ago.)soluble fertilizers (23 seconds ago.)ol妹子自抠粉穴 (23 seconds ago.)handlerdata var (24 seconds ago.)50 background-size 100 (25 seconds ago.)учебные и наглядные пособия (26 seconds ago.)700 color 4e4c4c (26 seconds ago.)maxi-cosi (28 seconds ago.)king hunter (28 seconds ago.)domainabout-air-compressorscom expiressun (30 seconds ago.)all spend (31 seconds ago.)healthkart (32 seconds ago.)генеральный директор “группы “транзит-дв” принял участие в конференции “северный морской путь: стратегия возрождения” (33 seconds ago.)非机动车道的调研 (33 seconds ago.)basit eğlence (35 seconds ago.)