InspectionNews - Home Inspection

Safety: Low trust score
Year Founded: 2007
Global Traffic Rank: 518,692
Estimated Worth: $2,640

InspectionNews.net is the first, the largest and still the BEST independent home inspection resource and message board. InspectionNews has all the home inspection resources you could want.



Domain summary

Last updated
2021-01-25
Domain label
inspectionnews
Domain extension
net
Domain registered:
2007-03-06
Domain updated:
2018-11-21
Global Traffic Rank
518,692
Statvoo Rating
H
Trust Score
Low Trust Score
Estimated worth
$2,640
Estimated daily income
$11
Estimated monthly income
$335

Frequently Asked Questions (FAQ)

Q: When was Inspectionnews.net registered?
A: Inspectionnews.net was registered 14 years, 7 months, 2 weeks, 3 days, 17 hours, 24 minutes, 35 seconds ago on Tuesday, March 6, 2007.
Q: When was the WHOIS for Inspectionnews.net last updated?
A: The WHOIS entry was last updated 2 years, 11 months, 2 days, 17 hours, 24 minutes, 35 seconds ago on Wednesday, November 21, 2018.
Q: What are Inspectionnews.net's nameservers?
A: DNS for Inspectionnews.net is provided by the following nameservers:
  • ns1.inspectionnews.net
  • ns2.inspectionnews.net
Q: Who is the registrar for the Inspectionnews.net domain?
A: The domain has been registered at eNom, LLC.
Q: What is the traffic rank for Inspectionnews.net?
A: Inspectionnews.net ranks 518,692 globally on Alexa. Inspectionnews.net has a Low Trust Score, and a Statvoo Rank of H.
Q: How many people visit Inspectionnews.net each day?
A: Inspectionnews.net receives approximately 1,723 visitors and 3,446 page impressions per day.
Q: What IP address does Inspectionnews.net resolve to?
A: Inspectionnews.net resolves to the IPv4 address 192.232.198.229.
Q: In what country are Inspectionnews.net servers located in?
A: Inspectionnews.net has servers located in the United States.
Q: What webserver software does Inspectionnews.net use?
A: Inspectionnews.net is powered by Apache webserver.
Q: Who hosts Inspectionnews.net?
A: Inspectionnews.net is hosted by Unified Layer in Texas, Houston, United States, 77092.
Q: How much is Inspectionnews.net worth?
A: Inspectionnews.net has an estimated worth of $2,640. An average daily income of approximately $11, which is roughly $335 per month.

Inspectionnews.net Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Inspectionnews.net Free SEO Report

Website Inpage Analysis for Inspectionnews.net

H1 Headings

1 :
  1. InspectionNews - Home Inspection

H2 Headings

39 :
  1. Technical Topics For Home, Commercial & Environmental Inspections Threads / Posts  Last Post
  2. Attic Areas: Home Inspection and Commercial Inspection
  3. Building Envelope: Home Inspection and Commercial Inspection
  4. Building Interior: Home Inspection and Commercial Inspection
  5. Built-In Appliances and Systems: Home Inspection and Commercial Inspection
  6. Electrical Systems: Home Inspection and Commercial Inspection
  7. Environmental, Pests, Health and Safety: Home Inspection and Commercial Inspection
  8. Exterior Systems: Home Inspection and Commercial Inspection
  9. Fireplaces, Chimneys and Solid Fuel Burning Appliances: Home Inspection and Commercial Inspection
  10. Heating, Ventilation, Air Conditioning (HVAC): Home Inspection and Commercial Inspection
  11. Plumbing System: Home Inspection and Commercial Inspection
  12. Pool and Spa: Home Inspection and Commercial Inspection
  13. Roofing System: Home Inspection and Commercial Inspection
  14. Structural Components: Home Inspection and Commercial Inspection
  15. Sub-Structure: Home Inspection and Commercial Inspection
  16. Thermal Imaging- Infrared IR
  17. VA, FHA, HUD, Disaster and Insurance Inspections: Home Inspection and Commercial Inspection
  18. Non-Technical Topics For Home, Commercial & Environmental Inspectors Threads / Posts  Last Post
  19. Associations, Ethics, Standards, Licensing, Legislation:Home Inspectors & Commercial Inspectors
  20. Business Operations: Home Inspectors & Commercial Inspectors
  21. Education: Home Inspectors & Commercial Inspectors
  22. Employment: Home Inspectors & Commercial Inspectors
  23. Expert Witness and Defect Litigation: Home Inspection & Commercial Inspection
  24. General Chit Chat: Home Inspectors & Commercial Inspectors
  25. InspectionBlues: Home Inspectors & Commercial Inspectors
  26. Inspection News From Around The Net
  27. Introductions By New Members
  28. Polls and Surveys
  29. Reports
  30. Safety Recalls and Notices
  31. Social Media Connections and Reciprocal Links
  32. Tools and Equipment
  33. H E L P !
  34. Women In The Inspection Business
  35. Home Owner, Home Buyer and DIY questions Threads / Posts  Last Post
  36. Questions from Home Owners, Home Buyers and DIY
  37.   Threads / Posts  Last Post
  38. Articles From The Inspection Community
  39. What's Going On?

H3 Headings

3 :
  1. Spam-O-Matic Statistics
  2. InspectionNews - Home Inspection Statistics
  3. Icon Legend

H4 Headings

102 :
  1. Forum Actions:
  2. Forum Statistics:
  3. Last Post:
  4. Forum Actions:
  5. Forum Statistics:
  6. Last Post:
  7. Forum Actions:
  8. Forum Statistics:
  9. Last Post:
  10. Forum Actions:
  11. Forum Statistics:
  12. Last Post:
  13. Forum Actions:
  14. Forum Statistics:
  15. Last Post:
  16. Forum Actions:
  17. Forum Statistics:
  18. Last Post:
  19. Forum Actions:
  20. Forum Statistics:
  21. Last Post:
  22. Forum Actions:
  23. Forum Statistics:
  24. Last Post:
  25. Forum Actions:
  26. Forum Statistics:
  27. Last Post:
  28. Forum Actions:
  29. Forum Statistics:
  30. Last Post:
  31. Forum Actions:
  32. Forum Statistics:
  33. Last Post:
  34. Forum Actions:
  35. Forum Statistics:
  36. Last Post:
  37. Forum Actions:
  38. Forum Statistics:
  39. Last Post:
  40. Forum Actions:
  41. Forum Statistics:
  42. Last Post:
  43. Forum Actions:
  44. Forum Statistics:
  45. Last Post:
  46. Forum Actions:
  47. Forum Statistics:
  48. Last Post:
  49. Forum Actions:
  50. Forum Statistics:
  51. Last Post:
  52. Forum Actions:
  53. Forum Statistics:
  54. Last Post:
  55. Forum Actions:
  56. Forum Statistics:
  57. Last Post:
  58. Forum Actions:
  59. Forum Statistics:
  60. Last Post:
  61. Forum Actions:
  62. Forum Statistics:
  63. Last Post:
  64. Forum Actions:
  65. Forum Statistics:
  66. Last Post:
  67. Forum Actions:
  68. Forum Statistics:
  69. Last Post:
  70. Forum Actions:
  71. Forum Statistics:
  72. Last Post:
  73. Forum Actions:
  74. Forum Statistics:
  75. Last Post:
  76. Forum Actions:
  77. Forum Statistics:
  78. Last Post:
  79. Forum Actions:
  80. Forum Statistics:
  81. Last Post:
  82. Forum Actions:
  83. Forum Statistics:
  84. Last Post:
  85. Forum Actions:
  86. Forum Statistics:
  87. Last Post:
  88. Forum Actions:
  89. Forum Statistics:
  90. Last Post:
  91. Forum Actions:
  92. Forum Statistics:
  93. Last Post:
  94. Forum Actions:
  95. Forum Statistics:
  96. Last Post:
  97. Forum Actions:
  98. Forum Statistics:
  99. Last Post:
  100. Forum Actions:
  101. Forum Statistics:
  102. Last Post:

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

147 :

Google Adsense

:
pub-6503521620184907

Google Analytics

:
Not Applicable

Links - Internal

277:

Links - Internal (nofollow)

47:

Links - Outbound (nofollow)

0:

Keyword Cloud for Inspectionnews.net

ifforums rss feedenvironmentalinspectionnews homefeedamp commercialview forumyahooutildomsetstylenavbarpasswordhintlinksfunctionbracingforumsgunnar alquist viewhome inspectionsappliancesdompostsnbspforum actionsview forum postsyahooutildomsetstylenavbarpasswordifelsistyledisplaynoneelsistyledisplay ifforum statisticsrssjerrylast postinspections forum actionsview profile viewvisit homepagefeed forum statisticsstatistics threadsyourquestionmessage boardlastcommercialforum statistics threadsadsbygoogle windowadsbygoogleposts private messageprofile view foruminspectorpeckhome inspectionprotectiondagostino viewinlineyahooutildomsetstylenavbarpasswordhint displayamp commercial inspectorssafetyposts privatenonebusinessprivate messageinspectionhome inspections amptextboxvalueforumwindowadsbygoogle pushampinspectionsamp environmentalpermissionpostsystems home inspectionequipmenttextbox yahooutileventgettargete ifview this forumsadsbygoogle windowadsbygoogle pushrss feed forumyahooutileventgettargete if textboxvaluemessagewindowonloadoldonloadtextboxallwindowadsbygooglehomepagedisplayifelsistyledisplayelsistyledisplayvar textboxforum posts privatehome buyerdo youcommercial inspections forumactionsthreads postsnbspinspectorsdisplay inlinegunnar alquistpostsnbsp last postadsbygooglevarprivate message visitpeck viewpeck view profileyahooutileventgettargetetextbox yahooutileventgettargetealquist viewalquistcommercial inspectorsvar textbox yahooutileventgettargeterss feedatticinspectors forumpostsjerry peckyahooutildomsetstylenavbarpassword displayalquist view profileventdodom dagostino viewinspection and commercialpost articlethreads postsnbsp lastif textboxvalueifelsistyledisplaynoneelsistyledisplayvisitelslenpushjerry peck viewdagostinoamprivateinspectors forum actionscommercial inspectionslast post articlepostsnbsp lastheatingsystems homeyahooutileventgettargete ifdagostino view profilepmdrainsinspections amp commercialinsuranceactions viewforum actions viewhome inspectorsinspectionnewsnetanyinspectors ampinspectionnewsprofileinspectors amp commercialthreadsventilationview profilemarketingdisplay nonegunnarsystemsdom dagostinoprofile viewinspections ampmembersforums rssinspectionnews home inspectionforum postsmessage visit homepagepipingmemberhome inspectors ampyouhome ownerbuyeramp commercial inspectionshelpstatisticsmoldinspections forumnewusepleasemessage visittopics11252020topics for homearticlehomeownerboardfeed forumcommercial inspectionviewcommercial inspectors forumspammers

Longtail Keyword Density for Inspectionnews.net

KeywordsOccurences
forum statistics threads34
forum posts private33
posts private message33
view forum posts33
profile view forum33
view profile view33
feed forum statistics33
rss feed forum33
forums rss feed33
view this forums33
forum actions view33
private message visit16
message visit homepage16
inspections forum actions16
commercial inspections forum15
amp commercial inspections15
inspections amp commercial15
home inspections amp15
inspection and commercial15
inspectors amp commercial12
amp commercial inspectors12
home inspectors amp11
inspectors forum actions7
commercial inspectors forum6
jerry peck view4
peck view profile4
var textbox yahooutileventgettargete4
alquist view profile4
postsnbsp last post4
threads postsnbsp last4
gunnar alquist view4
textbox yahooutileventgettargete if3
last post article3
systems home inspection3
dom dagostino view3
dagostino view profile3
topics for home3
inspectionnews home inspection3
adsbygoogle windowadsbygoogle push3
yahooutileventgettargete if textboxvalue3
last post38
statistics threads35
forum actions35
forum posts35
forum statistics34
private message33
view forum33
feed forum33
rss feed33
forums rss33
actions view33
view profile33
posts private33
profile view33
amp commercial28
home inspection22
inspections forum17
commercial inspection17
home inspections17
visit homepage16
message visit16
commercial inspections16
inspections amp15
commercial inspectors13
inspectors amp13
home inspectors12
inspectors forum7
jerry peck4
peck view4
message board4
ifelsistyledisplaynoneelsistyledisplay if4
alquist view4
postsnbsp last4
threads postsnbsp4
var textbox4
textbox yahooutileventgettargete4
gunnar alquist4
yahooutileventgettargete if3
home buyer3
home owner3
yahooutildomsetstylenavbarpassword display3
do you3
display none3
if textboxvalue3
dagostino view3
dom dagostino3
adsbygoogle windowadsbygoogle3
systems home3
post article3
windowadsbygoogle push3
inspectionnews home3
amp environmental3
display inline3
yahooutildomsetstylenavbarpasswordhint display3
forum109
view101
posts71
home61
inspection49
commercial48
last40
threads39
post38
message37
inspections37
statistics36
actions35
forums35
private35
rss33
feed33
profile33
amp32
inspectors31
pm19
visit18
var16
if16
am16
homepage16
function10
you9
inspectionnews9
new9
systems7
display6
inspectionnewsnet5
equipment5
do5
ifelsistyledisplayelsistyledisplay4
all4
inspector4
jerry4
peck4
ifelsistyledisplaynoneelsistyledisplay4
elslen4
windowonload4
members4
board4
links4
insurance4
any4
environmental4
ventilation4
alquist4
postsnbsp4
textboxvalue4
yahooutileventgettargete4
your4
textbox4
gunnar4
oldonload3
none3
marketing3
member3
buyer3
yahooutildomsetstylenavbarpassword3
owner3
permission3
adsbygoogle3
please3
windowadsbygoogle3
push3
inline3
spammers3
yahooutildomsetstylenavbarpasswordhint3
business3
dom3
article3
safety3
appliances3
vent3
attic3
mold3
protection3
dagostino3
topics3
heating3
piping3
drains3
bracing3
use3
question3
11-25-20203
help3

Who hosts Inspectionnews.net?

Inspectionnews.net Hosting Provider Information

Hosted IP Address:192.232.198.229
Hosted Hostname:ins.inspectionnews.net
Service Provider:Unified Layer
Hosted Country:United StatesUS
Location Latitude:29.8284
Location Longitude:-95.4696
Webserver Software:Apache

Is "Unified Layer" in the Top 10 Hosting Companies?

Name
Percentage
GOOGLE
15.4249%
Unknown
11.7059%
AS-26496-GO-DADDY-COM-LLC
4.1307%
NAMECHEAP-NET
3.3122%
AMAZON-AES
2.5118%
GoDaddy.com, LLC
2.1535%
UNIFIEDLAYER-AS-1
2.1315%
Fara Negar Pardaz Khuzestan
1.7839%
CONFLUENCE-NETWORK-INC
1.5636%
1&1 Internet AG
1.4878%
Unified Layer
0.1156%

HTTP Header Analysis for Inspectionnews.net

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Mon, 25 Jan 2021 23:01:35 GMT
Server: Apache
Cache-Control: private
Pragma: private
Vary: Accept-Encoding,User-Agent
Content-Encoding: gzip
Content-Length: 15931
Content-Type: text/html; charset=ISO-8859-1

Inspectionnews.net Domain Nameserver Information

HostIP AddressCountry
ns1.inspectionnews.net 192.254.158.245
ns2.inspectionnews.net 192.254.158.246


Need to find out who hosts Inspectionnews.net?


Domain Registration (WhoIs) information for Inspectionnews.net

 Domain Name: inspectionnews.net
Registry Domain ID: 858087311_DOMAIN_NET-VRSN
Registrar WHOIS Server: WHOIS.ENOM.COM
Registrar URL: WWW.ENOM.COM
Updated Date: 2018-11-21T04:18:30.00Z
Creation Date: 2007-03-06T18:41:22.00Z
Registrar Registration Expiration Date: 2021-03-06T18:41:22.00Z
Registrar: ENOM, INC.
Registrar IANA ID: 48
Domain Status: clientTransferProhibited https://www.icann.org/epp#clientTransferProhibited
Registrant Name: REDACTED FOR PRIVACY
Registrant Organization: REDACTED FOR PRIVACY
Registrant Street: REDACTED FOR PRIVACY
Registrant Street:
Registrant City: REDACTED FOR PRIVACY
Registrant State/Province: CA
Registrant Postal Code: REDACTED FOR PRIVACY
Registrant Country: US
Registrant Phone: REDACTED FOR PRIVACY
Registrant Phone Ext:
Registrant Fax: REDACTED FOR PRIVACY
Registrant Email: https://tieredaccess.com/contact/16f0d0eb-afac-4d05-9854-58f3103f41ac
Admin Name: REDACTED FOR PRIVACY
Admin Organization: REDACTED FOR PRIVACY
Admin Street: REDACTED FOR PRIVACY
Admin Street:
Admin City: REDACTED FOR PRIVACY
Admin State/Province: REDACTED FOR PRIVACY
Admin Postal Code: REDACTED FOR PRIVACY
Admin Country: REDACTED FOR PRIVACY
Admin Phone: REDACTED FOR PRIVACY
Admin Phone Ext:
Admin Fax: REDACTED FOR PRIVACY
Admin Email: REDACTED FOR PRIVACY
Tech Name: REDACTED FOR PRIVACY
Tech Organization: REDACTED FOR PRIVACY
Tech Street: REDACTED FOR PRIVACY
Tech Street:
Tech City: REDACTED FOR PRIVACY
Tech State/Province: REDACTED FOR PRIVACY
Tech Postal Code: REDACTED FOR PRIVACY
Tech Country: REDACTED FOR PRIVACY
Tech Phone: REDACTED FOR PRIVACY
Tech Phone Ext:
Tech Fax: REDACTED FOR PRIVACY
Tech Email: REDACTED FOR PRIVACY
Name Server: NS1.INSPECTIONNEWS.NET
Name Server: NS2.INSPECTIONNEWS.NET
DNSSEC: unsigned
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.4259744689
URL of the ICANN WHOIS Data Problem Reporting System: HTTP://WDPRS.INTERNIC.NET/
>>> Last update of WHOIS database: 2021-01-25T23:01:37.00Z

Websites with Similar Names

Inspe.xyz
In spe
Inspeak.ru
inSpeak - английский язык онлайн, курсы английского языка online.
Inspeakagents.com
inspeakagents.com - Registered at Namecheap.com
Inspeakcoverage.com
503 Service Temporarily Unavailable
Inspeakinsurance.com
Arlington, TX Insurance Agents | InsPeak | Texas
Inspeakquotes.com
503 Service Temporarily Unavailable
Inspearit.info
Inspearit.com

Recently Updated Websites

Telematik-visionmaxx.net (5 seconds ago.)Hiveatlas.org (9 seconds ago.)Oyluyo.com (9 seconds ago.)Nhugu.com (10 seconds ago.)Predicadores.org (10 seconds ago.)Daphneaarts.com (15 seconds ago.)Vegankroket.com (15 seconds ago.)Universalmusic.se (16 seconds ago.)Bluepedalmedia.com (20 seconds ago.)Yulevip330.app (21 seconds ago.)Haltonhomechiropody.co.uk (22 seconds ago.)Poser.fit (24 seconds ago.)Inalahan.com (24 seconds ago.)Brittneyklusephotography.com (24 seconds ago.)Avaalexander.com (26 seconds ago.)Vadm.com (26 seconds ago.)Flickharrison.com (28 seconds ago.)Elyonconsultants.com (31 seconds ago.)Dermatologyspecialtypharmacy.com (33 seconds ago.)Ifixhere.com (34 seconds ago.)Diegotovardesign.com (35 seconds ago.)Museumofresilience.org (37 seconds ago.)Guwahatiforum.com (38 seconds ago.)Abgha.org (44 seconds ago.)Bitware.biz (44 seconds ago.)Yaoxiangzhan.com (45 seconds ago.)Rockcherry-ad.com (45 seconds ago.)Nnjptp.com (45 seconds ago.)Luxurydestinationsandwellnessretreats.com (48 seconds ago.)Thermeuk.com (49 seconds ago.)

Recently Searched Keywords

yeucoincom (2 seconds ago.)испания танец фламенко (2 seconds ago.)telegram trading group (2 seconds ago.)job bank canada ios app (3 seconds ago.)topics 0 (5 seconds ago.)sgs produce (7 seconds ago.)popular leora (8 seconds ago.)مشاعره با م (9 seconds ago.)job of receptionist in hospital (9 seconds ago.)как добавить баннер в вк (13 seconds ago.)سامانه حضور  (13 seconds ago.)senior tarifcomment (18 seconds ago.)acero y chapa (21 seconds ago.)metallic deck (22 seconds ago.)february 26 2020 (23 seconds ago.)distancing strongly (24 seconds ago.)fleece (27 seconds ago.)prices realized 08 (30 seconds ago.)south2 (31 seconds ago.)nbspnbsp 0 nbspnbsp (32 seconds ago.)train-adapt-survive (33 seconds ago.)ftbol (34 seconds ago.)weg zu deinen ölen (34 seconds ago.)017b622e-eec0-4af3-ae22-729f8d9d68a2.jpeg (36 seconds ago.)f14041important bookly-form (37 seconds ago.)con mvil mayka (37 seconds ago.)our features online admission (38 seconds ago.)customs academy (38 seconds ago.)cpns tanpa formasi administrasi (39 seconds ago.)daily challenge_february (40 seconds ago.)