Flowers Delivered - Send Flowers Online with Interflora UK

Safety: Low trust score
Year Founded: 1996
Global Traffic Rank: 76,028
Estimated Worth: $154,080
Category: Shopping > Flowers

Order flowers online from Interflora. Same day delivery available. All bouquets are expertly crafted by local florists and hand-delivered to the door.



Domain summary

Last updated
2020-10-06
Domain label
interflora
Domain extension
co.uk
Domain registered:
1996-08-00
Domain updated:
2020-09-10
Global Traffic Rank
76,028
Statvoo Rating
E
Trust Score
Low Trust Score
Estimated worth
$154,080
Estimated daily income
$214
Estimated monthly income
$6,509

Rank summary

How is interflora.co.uk ranked relative to other sites:

Percentage of visits to interflora.co.uk from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Interflora.co.uk registered?
A: Interflora.co.uk was registered 24 years, 9 months, 2 weeks, 1 day, 5 hours, 4 minutes, 34 seconds ago on Wednesday, July 31, 1996.
Q: When was the WHOIS for Interflora.co.uk last updated?
A: The WHOIS entry was last updated 8 months, 5 days, 5 hours, 4 minutes, 34 seconds ago on Thursday, September 10, 2020.
Q: Who is the registrar for the Interflora.co.uk domain?
A: The domain has been registered at Nominet UK.
Q: What is the traffic rank for Interflora.co.uk?
A: Interflora.co.uk ranks 76,028 globally on Alexa. Interflora.co.uk has a Low Trust Score, and a Statvoo Rank of E.
Q: How many people visit Interflora.co.uk each day?
A: Interflora.co.uk receives approximately 17,809 visitors and 106,854 page impressions per day.
Q: What IP address does Interflora.co.uk resolve to?
A: Interflora.co.uk resolves to the IPv4 address 85.133.85.154.
Q: In what country are Interflora.co.uk servers located in?
A: Interflora.co.uk has servers located in the United Kingdom.
Q: What webserver software does Interflora.co.uk use?
A: Interflora.co.uk is powered by webserver.
Q: Who hosts Interflora.co.uk?
A: Interflora.co.uk is hosted by Adapt Services Ltd in United Kingdom.
Q: How much is Interflora.co.uk worth?
A: Interflora.co.uk has an estimated worth of $154,080. An average daily income of approximately $214, which is roughly $6,509 per month.

Interflora.co.uk Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Interflora.co.uk Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Interflora.co.uk

H1 Headings

1 :
  1. Get fresh flowers delivered anywhere in the UK

H2 Headings

7 :
  1. SEND FLOWERS FOR EVERY OCCASION
  2. see what we've been working on
  3. More than blooms
  4. One-of-a-kind seasonal designsCreated by our Local Artisan Florists
  5. Customer Reviews
  6. Flower Edits
  7. Sign up to our Newsletters and email offers

H3 Headings

11 :
  1. Sending flowers just got personal
  2. #ShareSomethingReal with a one-of-a-kind gift crafted with love by one of our local, artisan florists.
  3. Hamper Gifts
  4. Bring a little sunshine into the home with one of our beautiful
  5. Plants
  6. The other
  7. side of the worldis lucky to have you.
  8. #ShareSomethingReal
  9. Hands-free gifting is here
  10. Kind-to-the planet packaging
  11. The Interflora difference

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

17 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-43722082-1

Links - Internal

128:

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Interflora.co.uk

display inline letterspacingsquare in otherfontfamily open sansease ahoversansserif fontweight bolddocumentgetelementbyidtimedcontentinnerhtml0 0 0none fontweightwidth100coverpadding0px1663pxuppercase top 10pxvaluebirthday100 minwidth 998pxjustifycontent center0 0 07100 textalign centerheight 60100 maxwidthmarginlefttextalign center colormargin 10pxdocumentgetelementbyidshowerstyledisplay nonebasketnumclear clearorderuse whateverauto 1fontfamily openfontfamily hco gothamgiftswidth 240pxourfontsizeleft 0 righttransition height 500msfffffffontweight normalauto fontfamily openpointerheight autoany percentage widthcolor fff textdecoration255 255000 fontfamily open20px textalign centercenter texttransform uppercase5minwidthfooterinfobox0 textalignstandard photo0 1parent containerhellolocalsustainablelpviewcolortexttransform uppercase top100 meansright 0golden ratio12px fontweightcontent display15pxfontfamily hcoend golden ratiomargin 10px automastercarddate11px fontweightrelative topinline letterspacingbottomauto12px color caad59fontsize 11pxmediausfontsize 2vwst1fill999999 transitionfontfamily helveticablock stickycsstransitionfontsize 14px fontfamilysetpercentage width 10014pximportantwords paddingbottomcan useuse add overflowhiddenuppercase topwhichcontainerusescreen and minwidthabsolute bottom 5pxwhite0px marginleft 0pxalinkwindowlocation9other wordstableccctimedlinkidparentcssdisplaynonehideleft and showbackgroundsize cover backgroundpositionhide the signinhome1 0textalign center toptextshadowarial fontweightbold fontsizefloristsmargintopbackgroundsize coverb49a4f16px fontweight boldfloatwithinyesmargin 0 automoreright 10px14px fontweightfontfamily arial helveticaease leftcontent float leftfontsize 12px colorinternationalleft 0pxwidth 100 minwidthavisited fontfamily arialfontweightfindstickyhomepageseotextinnerif thisvalpadding 10pxposition fixedtrueclear bothdivsticky pccdocumentgetelementbyidcheckoutonclickfunctionpccpaddingbottomcontent expandsst1fill999999 transition allcursor pointerelementclear clear bothfontweight normal colorendshopcartcenter widthhtmldeliveryaspectsansserif fontfamilynone width14px fontfamily998pxfffsameday flowers12px color fffanynbspcolor cccbusiness3vwarial helvetica sansserifpccfallbackamenduse addright 0 textalignfontsize 16px fontweight16pxauto fontfamilyatagoffsettop 750 alertthenormal fontweight normalshoporderspadding 15pxpadding 0pxaspect ratio0 07amithendocumentgetelementbyidcheckoutpopupstyledisplayblock1 autodocumentwriteborder 1pxfind out0px importantfontsize 16px important15px 20pxgetsdnd20pxoverflow hidden5pxclearfixratio standardallfloristeditorialinline letterspacing 02emcolor fff position0px marginleftbuttonfontstyle normal fontweightalertsetwidth 50000 fontfamilydocumentgetelementbyidpchorizontalstyledisplay block stickycsstransitionessentially1045pxabsolute topnone cursorproportionsease left 0lineheightwidth 80rgba0height 10pxrgba255 255 255scrolltopratio bannerotherfff fontfamily arialbrtrkpcgolengthatagoffsettopcolor fff fontfamilyhelvetica sansserif arialremainfontweight normal seolinksfontweight bold leftmeans the divparentahover240pxfontstyle normaltextdecorationnonepercentage width10vwboldusually use11px50 fontsize 15px0pxoverflowhidden500ms ease ahovercenter colorcenter color fffmedia onlyhcocolor b49a4ftextalign center widthdocumentgetelementbyiddefaultcontentinnerhtml documentgetelementbyidtimedcontentinnerhtmltextdecorationunderlinegolden ratio standardabsolutesansserif fontsize 12pxfind out more500ms ease lefttextdecoration none colorexpands beyondsansserif arial fontweightbold255 09position relative margineasefontsize 16pxcolor 000dayfirst marginleftexpandsuppercasedocumentgetelementbyidhiderstyledisplay nonemargin 0pxposition absolute bottomdocumentgetelementbyidshowerstyledisplayglobal nav leftdocumentgetelementbyidshowerstyledisplay none documentgetelementbyidpchorizontalstyledisplayfloat left heightnewhereleft 20pxsigndocumentgetelementbyiddefaultcontentinnerhtmlright 10px topclearfix you usually5px display noneuse whatever clearfixcarttotalbrandp500ms ease stickycssheightloginpopupopenloginpopupst1fill999999sympathy flowersopen sansheight 500ms easewidth 100 textalignclearfix you10px auto fontfamilycenter position absolute8ratio 100helveticaclearnone displayblockusuallybottom 0pxwordsmarginleft 0pxbutton was clicked1px solidcontent floatarial fontweightboldmargin 0px 0pxalertthelogoutfontsize 15pxalink fontfamilybackgroundcolor rgba255textdecorationsign upheight 50pxwidth within10px width 502emvideotopnew date500ms easesansserif fontsize 16pxyoufootertextwhite2vwwhatever clearfixthisvalsansserif fontsizebackgroundcolor whitestandard photo proportionsborder 1px solidtransformpintrestfontstyle3pxwidth 100 display0000000 margin 007scrolltop atagoffsettop 750position relativegotham sansserifmaxwidth 600pximg width0 right 0content expands beyondaddnone documentgetelementbyidshowerstyledisplaybackgroundcolor fff0 auto16px fontweightnormalsansserifmainpromocopy10px toponly screenwithin the parentoverflow3textaligncenterdisplayrightsympathywhatever clearfix you0 margin autoheightauto7widthfontweight bold backgroundcolorparent cancentercountriesnav left10px widthlineheight 14emfunctionratio banner proportionsreturnclickedshowerdocumentgetelementbyidglobalscvsigninstyledisplaypcpostcode pccountytowndeltaahover fontfamilyscrolltop atagoffsettoparialeveryheaderlinksbloggiftlogout buttonposition relative top1663 media onlymedia only screensrc5px displaymainpromoinnerpositionfootersecuretextsame daybodyonclickbrand reviewsshow the logoutphoto proportionsfontfamily helvetica sansserifavisitedhco gothamstickycsstransition height 500mssansserif fontsize 14pxshowhideflag visibleelectroncenter positionfontsize 11px fontweightnone cursor pointeramexbannersansserif arialbrdatatextalign center positionsimplytexttransform nonewidth 1045px0px autoelements100 height000 colorfacebook13funeralopenhtml bodyanimate4add overflowhidden1 auto 1essentially the aspectbeyond 998pxhomepageproductinline ifdocumentgetelementbyidcheckout500msinline02emhiddenbold left300px10paypalst0fillffffffmargin 20pxvisamarginbottom100 minwidthparent elementseolinkstallfootercontainercolor caad59 textalignsanscolor caad59 textdecorationbackgroundcolor rgba0 0fullwidthcontentimportant width 100fontfamily arialsiteauto widthmainpromocopy spanmpsmallsecondarycentredtextdecoration underlineifdocumentgetelementbyidcheckoutwidthautodiv will remaindocumentgetelementbyidhiderstyledisplayifdocumentgetelementbyidglobalscvsigninelsedisplay nonecellcontainer5html bodyanimate scrolltoptexttransform uppercaseimportantoutcellcontainer3255 255 09normal fontweightborderradius0 pccmargin autosignincolor66613pxpadding 15px 20px1megamenudropdowncssvisibilityhiddenbold backgroundcolor rgba255percentage100 display998px 60documentgetelementbyidcheckoutpopupstyledisplay nonehelvetica sansserif fontweightjustifycontentrgba255nofff textdecoration nonerelative margin10px fontsizefontweight bold colorwidth 100 heightavisited fontfamily50px textalignuppaddingmessages600pxposition absolutebothaspect ratio 100display tableyou can usereviewsnone coloropen sans arialleft essentiallymaxwidthscreenmeansdocumentgetelementbyidpchorizontalstyledisplaybanner proportionscenter margin 10pxfontsize 15px display0 marginrgba255 255inline ifdocumentgetelementbyidcheckout documentgetelementbyidcheckoutonclickfunctionhco gotham sansserifpccountytowntransition heightglobalfontweightbold fontsize15px display inlinecolor ffffff067em12which content expandspcoccasionfieldtop 10pxcaad59 textdecorationyes varcolumnsectionheight 500msnorepeatzindexhelpposition absolute widthfalsesansserif fontweightletterspacing 02eminstagramwindowlocation shopcartdiv backgroundcolormainsectionauto topwhateveriffontsize 14pxfixedany percentageauto right 0display none cursor0 rightletterspacingbeyondcolor caad59sansserif coloryou usually usegridfloat the parentleft 014px fontfamily open15px displaycenter topabsolute widthfontweightbold fontsize 12px50px12px colorsolidsans arialprevclickedelementmargin 0contentwedisplay inlineblockwide2pxbackgroundcolore7e7e7important widthexpands beyond 998pxelement or simplyfontsize 12px fontweighttable clear bothnormal colordisplay inlinebackgroundcolor rgba255 255can30px importantbottom 5px displaydisplayblockinlineblockundefinednone color 000rgba0 0width 100globalscvloggedinclearukfff fontfamilyfloat lefttransition0emhiderfff positionbeginopen sans sansserifratio 100 means2ratiohttpsfloatleftpcc copy0px marginbackgroundimagefontweight boldgothamstickycsstransitionborderfontweightboldhelvetica sansserif16px importantend goldenstandarddocumentgetelementbyidpchorizontalstyledisplay blockease stickycssheight1pxgmtrelative width0 0background none0px margin 0pxbodyanimatefontsize 14px fontweightnone documentgetelementbyidpchorizontalstyledisplay block60 of 1663function htmlleft height50px textalign centersansserif fontsize 11pxfnameblock stickycsstransition heightsignin formsurepccountytownfieldbackground none colorcheckbottom 5px1663 mediaabsolute bottomminwidth 998pxpadding 0pccfallbackamend endcenter texttransformshowhideflagletterspacing 01emdiscoverpccfallbackamend beginnowwidth 50 fontsizeleftfontfamily amithenpcwidgetformtexttransforminterflorabackgroundcolor rgba0fff textdecorationdocumentreadyfunctionurltextalignrightbold left 001emflowers sympathyoccasionimportant padding 0pxcolor 000 fontsizebottom 0float left essentiallysquarebackgroundcolor14px fontweight bold11px fontweight normalbackgroundsizetop 10px widthphotocontent display tableimportant paddingcursornavformcellcontainer4flowerstickycssheightfirst14sans arial helveticaimg width 100emailall 500mshelvetica sansserif fontsizetransition all 500mspcpostcodefield pccountytownfieldtransition allleft 0 marginright 0 margin8pxusually use add11relativeglobal navatagoffsettop 750bold backgroundcolor30pxunderlinetextalign center20px textaligncan use whateveryou usuallycolor 666padding 20pxtable clearflowerswidth 100 importantcolor fffbackgroundcolor caad590 auto rightpointposition absolute top14px20px bordersans sansseriffontsize 12pxtextdecoration none fontweightbeyond 998px 60simply floatspanmpsmallsecondarypccalendarfieldcenter margindiv backgroundcolor whiteimgmainpcccontainercolor 000000plantsall 500ms easetextbackgroundgoldenfunction html bodyanimateminwidth 1663pxstickycsstransition heightrgba0 0 00px 0px 0pxiflatestwork14emratio standard photoout morecolor 000 fontfamilycaad59 colortextalign center texttransformcopysans sansserif fontfamily0000 fontsizedocumentgetelementbyidhiderstyledisplay none documentgetelementbyidshowerstyledisplaybackgroundcolor 000footerpaymentlinksnormal seolinks000width 100 maxwidthmargin 0px autoclasstwitterarial sansserifclicked bodyonclicktextdecoration none10px750 alertthe0px 0pxauto rightother words paddingbottomsectionsmargin 1 autoshowyou canbodyanimate scrolltoppadding 0px margincover backgroundpositionifdocumentgetelementbyidcheckout documentgetelementbyidcheckoutonclickfunctiononlytextalignpcpostcodefieldmarginglobalscvremembermewhich contenttypeofstickystickvarclearnone100 textalignbold colorfontfamilyminheight100 as tallfooterpayment50 fontsizecan be anygroupafterbreakarial helveticaheight 60 widthautovisibleyoutubenonebackgroundposition0 textalign centerampfff position absoluteh10960 widthautonewwidthdiscover moreposition relative widthmargin 1anniversaryh3caad59 textalignbeforepchorizontaldategettimewide or squarepcpostcode6none documentgetelementbyidpchorizontalstyledisplaytextalign center margincaad59 textalign centermaestrodisplay table clear10px autopoint at whichcaad59clearfix you can12pxbodyanimate scrolltop atagoffsettopgetserversdndepoccellcontainer2remain 100flexiblecontentdisplay blocknewheightheight100 importanth2

Longtail Keyword Density for Interflora.co.uk

KeywordsOccurences
arial helvetica sans-serif49
helvetica sans-serif font-size32
font-family open sans31
sans arial helvetica27
open sans arial27
font-family arial helvetica21
all 500ms ease14
transition all 500ms14
rgba0 0 014
margin 0 auto11
sans-serif font-size 16px10
none color 00010
height 500ms ease9
font-family helvetica sans-serif9
font-size 12px color9
helvetica sans-serif arial9
position absolute bottom9
means the div8
any percentage width8
percentage width 1008
content float left8
can be any8
float left essentially8
essentially the aspect8
aspect ratio 1008
ratio 100 means8
clearfix you can8
div will remain8
100 as tall8
wide or square8
square in other8
other words padding-bottom8
you can use8
clearfix you usually8
you usually use8
usually use add8
element or simply8
float the parent8
content display table8
display table clear8
table clear both8
within the parent8
use add overflowhidden8
position absolute top8
0 right 08
sans-serif font-size 14px8
whatever clearfix you7
500ms ease ahover7
helvetica sans-serif font-weight7
sans-serif font-weight bold7
color fff font-family7
st1fill999999 transition all7
height 60 widthauto7
sans-serif font-size 12px7
can use whatever7
use whatever clearfix7
border 1px solid7
14px font-weight bold6
rgba255 255 2556
font-size 14px font-weight6
0 margin auto6
12px color caad596
width 100 text-align6
left 0 right6
ratio banner proportions6
display inline letter-spacing6
15px display inline6
0 auto right6
color 000 font-family6
000 font-family open6
font-weight bold left6
bold left 06
left 0 margin6
0 margin 06
font-size 15px display6
right 0 margin6
auto right 06
right 0 text-align6
0 text-align center6
100 text-align center6
background none color6
text-align center position6
top -10px width6
position relative top6
clear clear both5
font-family hco gotham5
text-align center margin5
width 100 min-width5
100 min-width 998px5
button was clicked5
absolute bottom 5px5
font-style normal font-weight5
div background-color white5
position relative width5
stickycsstransition height 500ms5
0 0 075
fff font-family arial5
14px font-family open5
font-size 14px font-family5
fff text-decoration none4
color fff text-decoration4
center color fff4
font-weight normal color4
color fff position4
fff position absolute4
font-weightbold font-size 12px4
sans-serif arial font-weightbold4
arial font-weightbold font-size4
media only screen4
bottom 5px display4
width 100 max-width4
5px display none4
display none cursor4
none cursor pointer4
255 255 094
background-color rgba255 2554
bold background-color rgba2554
font-weight bold background-color4
16px font-weight bold4
font-size 16px font-weight4
20px text-align center4
text-align center width4
important padding 0px4
font-size 16px important4
0px 0px 0px4
text-align center color4
golden ratio standard4
ease left 04
background-color rgba0 04
50 font-size 15px4
inline letter-spacing 02em4
transition height 500ms4
color caad59 text-align4
500ms ease left4
caad59 text-align center4
-10px width 504
text-decoration none color4
font-weight bold color4
standard photo proportions4
ratio standard photo4
center position absolute4
auto font-family open4
color 000 font-size4
width 50 font-size4
uppercase top -10px4
color caad59 text-decoration4
text-align center text-transform4
open sans sans-serif4
sans sans-serif font-family4
center text-transform uppercase4
text-transform uppercase top4
find out more4
center margin 10px3
1663 media only3
show the logout3
60 of 16633
left and show3
global nav left3
beyond 998px 603
screen and min-width3
hide the signin3
text-decoration none font-weight3
font-weight normal seolinks3
12px color fff3
font-size 12px font-weight3
padding 15px 20px3
margin 0px auto3
width 100 height3
text-align center top3
avisited font-family arial3
content expands beyond3
sans-serif font-size 11px3
font-size 11px font-weight3
11px font-weight normal3
expands beyond 998px3
right 10px top3
which content expands3
margin 1 auto3
html bodyanimate scrolltop3
function html bodyanimate3
width 100 display3
hco gotham sans-serif3
position relative margin3
1 auto 13
background-size cover background-position3
scrolltop atagoffsettop 7503
0 0 03
float left height3
0px margin-left 0px3
padding 0px margin3
0px margin 0px3
50px text-align center3
bodyanimate scrolltop atagoffsettop3
atagoffsettop 750 alertthe3
point at which3
position absolute width3
margin 10px auto3
img width 1003
10px auto font-family3
margin 0px 0px3
end golden ratio3
normal font-weight normal3
important width 1003
documentgetelementbyidhiderstyledisplay none documentgetelementbyidshowerstyledisplay3
width 100 important3
500ms ease stickycssheight3
block stickycsstransition height3
documentgetelementbyidpchorizontalstyledisplay block stickycsstransition3
none documentgetelementbyidpchorizontalstyledisplay block3
documentgetelementbyidshowerstyledisplay none documentgetelementbyidpchorizontalstyledisplay3
inline ifdocumentgetelementbyidcheckout documentgetelementbyidcheckoutonclickfunction3
helvetica sans-serif58
arial helvetica49
width 10043
text-align center39
position absolute33
sans-serif font-size32
font-family open31
open sans31
font-weight bold29
sans arial27
position relative25
500ms ease24
font-family arial21
color 00018
0 018
color fff18
text-decoration none17
font-size 14px17
left 017
clearfix you16
clear both16
font-weight normal16
font-size 16px15
right 015
font-size 12px14
rgba0 014
color caad5914
transition all14
float left14
all 500ms14
0 margin12
min-width 998px12
margin 012
display block12
0 auto11
margin 0px11
none color10
height 500ms9
cursor pointer9
0px 0px9
display none9
12px color9
border 1px9
absolute bottom9
margin auto9
sans-serif arial9
font-family helvetica9
background none8
sans-serif font-weight8
display table8
width within8
you can8
parent container8
simply float8
parent element8
add overflowhidden8
use add8
usually use8
can use8
table clear8
words padding-bottom8
parent can8
other words8
remain 1008
100 means8
ratio 1008
aspect ratio8
content display8
content float8
percentage width8
any percentage8
left essentially8
you usually8
0 right8
margin-left 0px8
absolute top8
text-transform uppercase7
255 2557
fff font-family7
1px solid7
height 50px7
whatever clearfix7
padding 0px7
use whatever7
60 widthauto7
yes var7
ease ahover7
st1fill999999 transition7
font-style normal7
height 607
center position6
banner proportions6
relative top6
rgba255 2556
sans-serif font-family6
display inline6
100 text-align6
ratio banner6
pcc copy6
top 10px6
bottom 5px6
15px display6
0 text-align6
14px font-weight6
line-height 14em6
letter-spacing 01em6
font-size 15px6
000 font-family6
bold left6
auto right6
inline letter-spacing6
height auto6
top -10px6
-10px width6
clear clear5
padding 10px5
padding 05
same day5
day flowers5
new date5
padding 20px5
stickycsstransition height5
background-color rgba2555
14px font-family5
justify-content center5
margin 15
0 15
left 0px5
normal font-weight5
important width5
div background-color5
pcpostcode pccountytown5
background-color white5
0 075
100 min-width5
relative width5
font-family hco5
hco gotham5
padding 15px5
center margin5
color ffffff5
font-family amithen4
100 max-width4
bottom 0px4
max-width 600px4
text-transform none4
mainpromocopy spanmp-small-secondary4
media only4
bold color4
auto top4
only screen4
background-size cover4
none cursor4
sticky pcc4
uppercase top4
transition height4
fff position4
overflow hidden4
bold background-color4
img width4
30px important4
width 504
0px important4
50 font-size4
16px important4
center width4
width 240px4
center text-transform4
255 094
20px text-align4
letter-spacing 02em4
showhideflag visible4
brand reviews4
000 font-size4
16px font-weight4
out more4
center color4
5px display4
ease left4
avisited font-family4
font-weightbold font-size4
0px margin4
pcc-fallback-amend begin4
pcc-fallback-amend end4
background-color rgba04
caad59 text-decoration4
golden ratio4
color ccc4
ratio standard4
standard photo4
photo proportions4
background-color fff4
color b49a4f4
find out4
fff text-decoration4
important padding4
arial font-weightbold4
sans sans-serif4
width 1045px4
normal color4
auto font-family4
font-size 11px4
caad59 text-align4
1663 media3
inline ifdocumentgetelementbyidcheckout3
position fixed3
logout button3
ifdocumentgetelementbyidcheckout documentgetelementbyidcheckoutonclickfunction3
sign up3
11px font-weight3
absolute width3
global nav3
windowlocation shopcart3
nav left3
width 803
signin form3
clearnone displayblock3
auto width3
color 6663
color 0000003
margin 20px3
normal seolinks3
documentgetelementbyiddefaultcontentinnerhtml documentgetelementbyidtimedcontentinnerhtml3
min-width 1663px3
which content3
12px font-weight3
none font-weight3
expands beyond3
beyond 998px3
998px 603
content expands3
scrolltop atagoffsettop3
left 20px3
sans-serif color3
0px margin-left3
0px auto3
alink font-family3
15px 20px3
20px border3
caad59 color3
10px top3
right 10px3
50px text-align3
margin 10px3
10px auto3
first margin-left3
height 10px3
background-color caad593
1 03
000 color3
background-color 0003
end golden3
ahover font-family3
text-decoration underline3
if thisval3
sympathy flowers3
flowers sympathy3
left height3
display inline-block3
cover background-position3
1 auto3
pcpostcodefield pccountytownfield3
html bodyanimate3
100 important3
ease stickycssheight3
block stickycsstransition3
documentgetelementbyidpchorizontalstyledisplay block3
none documentgetelementbyidpchorizontalstyledisplay3
documentgetelementbyidshowerstyledisplay none3
none documentgetelementbyidshowerstyledisplay3
documentgetelementbyidhiderstyledisplay none3
clicked bodyonclick3
750 alertthe3
atagoffsettop 7503
bodyanimate scrolltop3
function html3
auto 13
discover more3
center top3
100 display3
arial sans-serif3
0 pcc3
bottom 03
gotham sans-serif3
font-size 2vw3
10px font-size3
relative margin3
100 height3
none width3
documentgetelementbyidcheckoutpopupstyledisplay none3
width123
0108
color87
font-family78
var77
font-size75
sans-serif72
position68
167
0px67
left64
helvetica62
none61
arial61
height60
top51
margin50
display49
font-weight48
auto46
center45
flowers41
text-align40
background-color39
padding34
absolute33
open32
20px32
if31
sans31
bold29
all28
10px28
function27
ease26
00026
right25
float25
fff25
relative25
normal25
225
500ms24
you24
parent24
content23
block23
clear23
important22
transition21
text-decoration20
14px20
16px19
can19
new19
caad5919
use18
background18
ratio18
line-height17
min-width17
998px17
bottom17
pcc16
both16
clearfix16
our16
12px16
ahover16
315
415
div15
border15
rgba014
else14
letter-spacing13
50px13
solid13
1px12
max-width12
15px12
30px12
511
margin-left11
end11
text-transform11
proportions10
no10
other10
container10
text-decorationnone10
padding-bottom10
day10
add10
delivery10
5px9
cursor9
carttotal9
inline9
undefined9
aspect9
white9
more9
pointer9
words9
font-style8
yes8
margin-top8
wide8
button8
usually8
any8
gotham8
within8
pcc-fallback-amend8
essentially8
alink8
means8
overflowhidden8
square8
element8
simply8
table8
hidden8
date8
remain8
tall8
avisited8
percentage8
rgba2557
border-radius7
clicked7
z-index7
hide7
sticky7
whatever7
uppercase7
blog7
gifts7
interflora7
widthauto7
st0fillffffff7
st1fill9999997
background-image7
img7
h16
homepage-product6
footer-info-box6
justify-content6
01em6
showhideflag6
screen6
0000006
-10px6
14em6
banner6
displayblock6
66
240px6
out6
brand6
ffffff6
copy6
show6
email6
3px6
floatleft6
media6
bodyonclick5
background-size5
facebook5
text-decorationunderline5
sympathy5
funeral5
first5
2vw5
twitter5
src5
footer-text-white5
pintrest5
now5
get5
footer-payment-links5
true5
font-weightbold5
thisval5
instagram5
visa5
order5
youtube5
amithen5
hco5
visible5
stickycsstransition5
find5
documentgetelementbyidpchorizontalstyledisplay5
shop5
reviews5
background-position5
pcpostcode5
uk5
2px5
documentgetelementbyidhiderstyledisplay5
075
documentgetelementbyidshowerstyledisplay5
only5
plants5
alertthe5
same5
width1005
business5
pccountytown5
094
stickystick4
up4
if-latest-work4
newwidth4
mainpromocopy4
newheight4
global4
delta4
electron4
spanmp-small-secondary4
florist-editorial4
74
mastercard4
mainpromo-inner4
class4
seolinks4
11px4
600px4
florists4
we4
pcpostcodefield4
video4
footer-payment4
overflow4
footer-secure-text4
pccountytownfield4
pcoccasionfield4
ccc4
84
text-aligncenter4
clearnone4
pcgolength4
photo4
cover4
prevclickedelement4
02em4
h34
067em4
1045px4
94
local4
b49a4f4
8px4
14pximportant4
heightauto4
url4
begin4
help4
here4
messages4
value4
documentreadyfunction4
return4
loginpopupopenloginpopup4
fname4
104
headerlinks4
false4
flexible-content4
documentgetelementbyidcheckoutpopupstyledisplay4
groupafter4
standard4
shower4
hider4
text-shadow4
grid4
3vw4
main-promo-copy4
main-pcc-container4
golden4
nbsp3
hello3
text-alignright3
getsdnd3
serversdndepoc3
check3
international3
basketnum3
typeof3
home3
0em3
footer-container3
10vw3
global-scv-loggedin3
set3
timedlinkidparentcssdisplaynone3
anniversary3
birthday3
amp3
global-scv-rememberme3
us3
transform3
brtrk3
shopcart3
windowlocation3
documentgetelementbyidcheckoutonclickfunction3
ifdocumentgetelementbyidcheckout3
documentgetelementbyidglobal-scv-signinstyledisplay3
ifdocumentgetelementbyidglobal-scv-signin3
logout3
nav3
form3
signin3
brdata3
color6663
amex3
documentwrite3
dategettime3
site3
no-repeat3
maestro3
margin-bottom3
underline3
paypal3
homepage-seo-text-inner3
view3
orders3
113
countries3
stickycssheight3
13px3
300px3
inline-block3
min-height3
fixed3
discover3
background-colore7e7e73
pccalendarfield3
pcwidgetform3
before3
pchorizontal3
gift3
cellcontainer33
alertset3
https3
main-section3
elements3
2em3
html3
bodyanimate3
h23
centred3
scrolltop3
occasion3
cellcontainer23
cellcontainer43
sign3
gmt3
atagoffsettop3
full-width-content3
column3
text3
sustainable-lp3
break3
sure3
p3
sections3
documentgetelementbyidtimedcontentinnerhtml3
documentgetelementbyiddefaultcontentinnerhtml3
flower3
cellcontainer53
123
1663px3
133
beyond3
expands3
which3
point3
megamenudropdowncssvisibilityhidden3
143
section3
padding0px3
every3

Who hosts Interflora.co.uk?

Interflora.co.uk Hosting Provider Information

Hosted IP Address:85.133.85.154
Hosted Hostname:85.133.85.154
Service Provider:Adapt Services Ltd
Hosted Country:United KingdomGB
Location Latitude:51.4964
Location Longitude:-0.1224
Webserver Software:Not Applicable

Is "Adapt Services Ltd" in the Top 10 Hosting Companies?

Name
Percentage
DoD Network Information Center
15.7948%
GoDaddy.com, LLC
8.0700%
Namecheap, Inc.
4.0119%
Confluence Networks Inc
2.6770%
Fara Negar Pardaz Khuzestan
2.1305%
Google Inc.
2.1184%
Merit Network Inc.
1.8272%
1&1 Internet AG
1.8076%
Cogent Communications
1.7178%
CloudFlare, Inc.
1.6296%
Adapt Services Ltd
0.0011%

HTTP Header Analysis for Interflora.co.uk

Http-Version: 1.1
Status-Code: 301
Status: 301 Moved Permanently
Date: Tue, 06 Oct 2020 15:24:47 GMT
Location: https://www.interflora.co.uk/
Content-Length: 237
Content-Type: text/html; charset=iso-8859-1
Age: 0
X-Cache: MISS from evdcifalpci01
Connection: keep-alive

Interflora.co.uk Domain Nameserver Information

HostIP AddressCountry
UnknownUnknownUnknownUnknown


Need to find out who hosts Interflora.co.uk?


Domain Registration (WhoIs) information for Interflora.co.uk

 Domain name:
interflora.co.uk

Registrant's address:
Interflora House
Watergate
Sleaford
Lincolnshire
NG34 7TB
United Kingdom

Data validation:
Nominet was able to match the registrant's name and address against a 3rd party data source on 10-Sep-2020

Registrar:
Elite Limited t/a Elite [Tag = ELITEUK]
URL: http://www.elite.net.uk

Relevant dates:
Registered on: before Aug-1996
Expiry date: 24-Oct-2020
Last updated: 10-Sep-2020

Registration status:
Registered until expiry date.

Name servers:
eprodns3a.interflora.co.uk 85.133.61.150
eprodns4a.interflora.co.uk 85.133.61.151

WHOIS lookup made at 16:24:48 06-Oct-2020

--
This WHOIS information is provided for free by Nominet UK the central registry
for .uk domain names. This information and the .uk WHOIS are:

Copyright Nominet UK 1996 - 2020.

You may not access the .uk WHOIS or use any data from it except as permitted
by the terms of use available in full at https://www.nominet.uk/whoisterms,
which includes restrictions on: (A) use of the data for advertising, or its
repackaging, recompilation, redistribution or reuse (B) obscuring, removing
or hiding any or all of this notice and (C) exceeding query rate or volume
limits. The data is provided on an 'as-is' basis and may lag behind the
register. Access may be withdrawn or restricted at any time.

Websites with Similar Names

Inter-acfinancial.com
Inter-Ac Financial – Just another WordPress site
Inter-act.ae
inter.act
Inter-act.education
inter-act.education
Inter-act.live
inter-act.live -&nbspinter act Resources and Information.
Inter-act.online
Database Error
Inter-act.ro
Interact - Web and media design studio
Inter-act.ru
Интерактив. Международные коммуникации

Recently Updated Websites

Tepsco.com (3 seconds ago.)Delitortillas.com (5 seconds ago.)Chelanvalleywellness.com (5 seconds ago.)Ladybugbikers.com (6 seconds ago.)Collegemoveinchecklist.com (7 seconds ago.)Barwonplaytherapy.online (7 seconds ago.)Itmonocular.site (7 seconds ago.)Agreementmine.com (8 seconds ago.)Mydoller.com (8 seconds ago.)Kevinkilpatrick.com (8 seconds ago.)Bigzoom.com (8 seconds ago.)Brottet.com (9 seconds ago.)Dinodavid.info (9 seconds ago.)Lisahunterford.com (10 seconds ago.)Urban8design.com (11 seconds ago.)Amidwifeforeverywoman.org (11 seconds ago.)Texashousedefaultbuyers.com (11 seconds ago.)Rdxhdmovies.xyz (12 seconds ago.)Dispensarist.com (12 seconds ago.)Sellspowertools.com (12 seconds ago.)Abouttownlockandkey.com (12 seconds ago.)Pittsburghdentalspas.com (12 seconds ago.)Thewinks.world (13 seconds ago.)Cps-berlin.com (13 seconds ago.)Xbdrtj.com (13 seconds ago.)Touchuptexas.com (13 seconds ago.)Medzentrum23.com (13 seconds ago.)Raleighsocialdiary.com (14 seconds ago.)Countrylandscapingllc.com (14 seconds ago.)Mogapractice.com (15 seconds ago.)

Recently Searched Keywords

dnjchina.com (1 second ago.)pro (1 second ago.)tiu hao y (1 second ago.)users full (1 second ago.)free access (2 seconds ago.)days ago free (3 seconds ago.)yes 100 just (4 seconds ago.)rockapella christmas (5 seconds ago.)sunny (9 seconds ago.)electroless nickel plating (9 seconds ago.)carbon blue (15 seconds ago.)ford (15 seconds ago.)tucson metrowater evaluation of 1,4-dioxane water sampling results (24 seconds ago.)nonprofit business (25 seconds ago.)automatically captures (30 seconds ago.)wisata yang indah membuat nyaman berada di new zealand (31 seconds ago.)yazar hseyin (31 seconds ago.)access only 1 (32 seconds ago.)21 1 (32 seconds ago.)1 per (37 seconds ago.)1 per day (44 seconds ago.)judgments or decisions (44 seconds ago.)content quality photo (48 seconds ago.)quality no no (48 seconds ago.)fľašky, hrnčeky a riady (50 seconds ago.)month this week (52 seconds ago.)ancho de banda (52 seconds ago.)week today (54 seconds ago.)our rules (54 seconds ago.)dccomicnews (55 seconds ago.)