|  Intermountain Healthcare
Low trust score  | Website Information

Website Ranks & Scores for

Statvoo Rank Statvoo Rank:D
Alexa Rank Alexa Rank:52,143
Majestic Rank Majestic Rank:46,393
Domain Authority Domain Authority:63%
DMOZ DMOZ Listing:No

Whois information for

Full Whois Lookup for Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

Registry Domain ID: D88833700-LROR
Registrar WHOIS Server:
Registrar URL:
Updated Date: 2016-10-07T17:24:05Z
Creation Date: 2002-07-29T15:44:52Z
Registry Expiry Date: 2018-07-29T15:44:52Z
Registrar Registration Expiration Date:
Registrar:, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Domain Status: clientDeleteProhibited
Domain Status: clientRenewProhibited
Domain Status: clientTransferProhibited
Domain Status: clientUpdateProhibited
Registry Registrant ID: C73081110-LROR
Registrant Name: Domain Admin
Registrant Organization: Intermountain Health Care Inc
Registrant Street: 4646 West Lake Park Blvd
Registrant City: Salt Lake City
Registrant State/Province: Utah
Registrant Postal Code: 84120
Registrant Country: US
Registrant Phone: +1.4425000
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: Login to show email
Admin ID: C73081116-LROR
Admin Name: Domain Admin
Admin Organization: Intermountain Health Care Inc
Admin Street: 4646 West Lake Park Blvd
Admin City: Salt Lake City
Admin State/Province: Utah
Admin Postal Code: 84120
Admin Country: US
Admin Phone: +1.4425000
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: Login to show email
Tech ID: C73081113-LROR
Tech Name: Domain Admin
Tech Organization: Intermountain Health Care Inc
Tech Street: 4646 West Lake Park Blvd
Tech City: Salt Lake City
Tech State/Province: Utah
Tech Postal Code: 84120
Tech Country: US
Tech Phone: +1.4425000
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: Login to show email
Name Server: EMAILD1.IHC.COM
Name Server: TX-EMAIL1.IHC.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form:
>>> Last update of WHOIS database: 2017-09-14T03:54:55Z

Who hosts is hosted by Dell, Inc. in Texas, Round Rock, United States, 78682. has an IP Address of and a hostname of Web Server Information

Hosted IP Address:
Hosted Hostname:
Service Provider:Dell, Inc.
Hosted Country:United StatesUS
Location Latitude:30.5175
Location Longitude:-97.6721
Webserver Software:Not Applicable

HTTP Header Analysis for

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Connection: Keep-Alive
Expires: Sat, 20 Jun 2015 11:21:27 GMT
Date: Sat, 20 Jun 2015 11:21:27 GMT
Content-Type: text/html; charset=utf-8
Server: Microsoft-IIS/7.5
Cache-Control: private
SPRequestGuid: 5962cb0f-1ac3-4a83-86ea-4af8025a33b6
X-SharePointHealthScore: 0
X-MS-InvokeApp: 1; RequireReadOnly
X-UA-Compatible: IE=edge,chrome=1
X-Powered-By: ARR/2.5
Transfer-Encoding: chunked
Content-Encoding: gzip
Vary: Accept-Encoding

Need to find out who hosts Free SEO Report

Website Inpage Analysis for

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for

learnhospitalslocationeventsphysicianshealthiestonlineits notinstacareusenavigation skipcontactpeoplebillclasseshealingitsintermountain healthcareourskip to intermountainyoucareuslive wellpossiblelearn more intermountainsiteneedlearn morehelping people livenewsclinicalintermountaincare nowqualityemergencyservicesresearchwellreportmorethroughskiplivehelpingmedicalnondiscriminationpayyoursearchlive the healthiesthealthpeople livehelping peoplepatientlives possiblehealthiest liveshealing for lifenothealthiest lives possiblemore intermountaingetget carelifeget care nowmedical servicesnowhealthcarehelplivesinformationtoolsfindnavigation

Longtail Keyword Density for

get care now5
live the healthiest5
healthiest lives possible4
helping people live4
healing for life3
learn more intermountain3
skip to intermountain3
learn more23
intermountain healthcare15
get care6
healthiest lives5
care now5
its not4
lives possible4
live well4
medical services4
helping people4
people live4
navigation skip3
more intermountain3

What are the nameservers for Domain Nameserver Information

HostIP AddressCountry States United States States United States States United States States United States Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if is a scam?