Irish Mirror: the latest news, showbiz, football and sport

Safety: Low trust score
Year Founded: 0000
Global Traffic Rank: 12,894
Estimated Worth: $194,400
Category: News and Media

Irish Mirror, the latest Irish news, showbiz, football and sport. Plus the best from the Daily Mirror in world news, showbiz and Premier League football



Domain summary

Last updated
2022-01-24
Domain label
irishmirror
Domain extension
ie
Global Traffic Rank
12,894
Statvoo Rating
C
Trust Score
Low Trust Score
Estimated worth
$194,400
Estimated daily income
$270
Estimated monthly income
$8,213

Frequently Asked Questions (FAQ)

Q: When was Irishmirror.ie registered?
A: Irishmirror.ie was registered 2022 years, 5 months, 3 weeks, 3 days, 16 hours, 34 minutes, 40 seconds ago on Monday, November 30, -0001.
Q: When was the WHOIS for Irishmirror.ie last updated?
A: The WHOIS entry was last updated 2022 years, 5 months, 3 weeks, 3 days, 16 hours, 34 minutes, 40 seconds ago on Monday, November 30, -0001.
Q: What are Irishmirror.ie's nameservers?
A: DNS for Irishmirror.ie is provided by the following nameservers:
  • ns-1453.awsdns-53.org
  • ns-1880.awsdns-43.co.uk
  • ns-205.awsdns-25.com
  • ns-540.awsdns-03.net
Q: Who is the registrar for the Irishmirror.ie domain?
A: The domain has been registered at .
Q: What is the traffic rank for Irishmirror.ie?
A: Irishmirror.ie ranks 12,894 globally on Alexa. Irishmirror.ie has a Low Trust Score, and a Statvoo Rank of C.
Q: How many people visit Irishmirror.ie each day?
A: Irishmirror.ie receives approximately 22,529 visitors and 135,174 page impressions per day.
Q: What IP address does Irishmirror.ie resolve to?
A: Irishmirror.ie resolves to the IPv4 address 54.228.196.66.
Q: In what country are Irishmirror.ie servers located in?
A: Irishmirror.ie has servers located in the Ireland.
Q: What webserver software does Irishmirror.ie use?
A: Irishmirror.ie is powered by webserver.
Q: Who hosts Irishmirror.ie?
A: Irishmirror.ie is hosted by Amazon.com, Inc. in Dublin City, Dublin, Ireland, D8.
Q: How much is Irishmirror.ie worth?
A: Irishmirror.ie has an estimated worth of $194,400. An average daily income of approximately $270, which is roughly $8,213 per month.

Irishmirror.ie Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Irishmirror.ie Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Irishmirror.ie

H1 Headings

0 :

H2 Headings

4 :
  1. Pat Flanagan column: 'Watershed' Ashling Murphy killing cannot be diluted down
  2. John Kierans column: Zero tolerance society needed after Ashling Murphy murder
  3. Siobhan O'Connor: 'I got Covid for a second time in a month'
  4. Luke O'Neill: 'My one reason for optimism that the Covid-19 pandemic may soon be behind us'

H3 Headings

5 :
  1. Sport
  2. What's On
  3. Lifestyle
  4. Showbiz
  5. GAA

H4 Headings

1 :
  1. Follow usFollow us

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

188 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-54854940-1

Links - Internal

743:

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Irishmirror.ie

earlycalledwere all liftedloafmoremyhomesharedfootballhitherdepartmenthurlingclubmuchkatiehas revealedweekshorrorgoingsheseverythingralfmajorhourslate latesweetshehousehold visitsalcoholweatherlistshow viewerschampionshipveryactorsnapoutdoor and indoorsector capacity7couldbeingmurphymost restrictionstwinshave beendowneasehelpjonesagedhappenedtwo yearssonsmoviewhichsingerleaveholidayfoundwerelookswarningopensannualfindnowralf rangnickevents nightclubsbreakdaughterhopeful updatecoronavirus irelandmeasureslookingtributeitsthrowbackcarsseenskinactressheaddiedtheylifted on saturdaylittlecarwesaysrevealsrangnickplayedbirthyearstarislanddancingissues8met eireann predictbidifrirelandmeasures on householdkellyleaguedarraghturnedpricekardashianout of hellstarshopefulneedneededpaidmartineventsfewsecretsagoworthenterweightpinnockthoughtcopeltz3shopgive hopefulwhatsgogiverulesagainstgreenticketssincebeenduringsaidcouplelatestbirthdayreactiongotliftedannual leavestephenareascantnolanpremisesaroundwarnedrestrictions on outdoorknowdevastatedshowsnewsfrommadeeachhospitalsomeonlyformertinderseriesexpertcostyearseireann predictend to alltaken offgoldfinalmet eireanndonnellycorkcountbookbrooklyncovid restrictionsindoor events nightclubswithindayrtepandemiceverything yougetdrivervisitsletbriancovidafter hertheredescribedtottenhamdays afterclaimed6awayclub hurlingvisits early closingtravelreleasetescosharesforecastplacenightclubs and covidafterhastodaydiespremises werehas sharedhisthingsproposalresultsbikiniannual leave youlatehusbandhousehealthtakesaylifeincidentcapacityadvicejanuaryendchatspottedownnewworkcrasheverearlieryouleave youuntilshowicemayuswinningifrcontentdocumentnightclubslostvspremises were allupcomingmarch4elsecapacity restrictionsenter premisesall things covidhimdatessoldcertsduesays shevarnooffallbatlidlmodelamphellmetwomenpaulrunningtheirannouncesdryindoorclosingpairmonthsupdatecoronaviruspricesmostlyhis wifepredictfansreturneireannsayingstoverthandatingleftbeforetookenter premises werethreehavewellwrestlemaniavaccinegarda siochanathenothiddencovid certsnearexpectedtwoneverifpostannouncedmichael9peoplesceneprisonfirstroadwifesupervaluwouldviewerslast5after sheenteringmengardaianothermoneysixlate late showrafflereleasedcomingmondaymumplanstellsstar sayshopeful updatecoronaviruschildrentakensetclashsectoridhospitality sectorchangesall thingsdontseenicolameanirelandyourrestrictionsdunnesshopswhilechangeindoor eventsamidweekholdenfacingaldinicola peltzwilliamsoutsidetimemomentnumberallirelandtopdeadnewscharactersfiancehousehold visits early0tvbuthospitalitygrimfamilywinhas beenreportedlymissbiggoalrealoutsaturdaycaseshis ownirelandsstrugglesmandeathfunctiongive hopeful updatecoronavirusoneincredibleunionjusttripturned awaymanyoutdoormillionwere alllookalikeirishmediahell singeruplegenddublinfourbestuniversityall liftedintomeansirelandmeasuresoldhadbankwelcomedmarriedanybat outvisits early2euromillionssharingbothhalfbehindafter beingdifferentlove islandsecondshouldthemchildheupdatecoronavirus irelandmeasuresmostwaymatchdayscelebratesosector capacity restrictionsback1lovesee an endsiochanathepraisehouseholdcontestantthings covidarrestedalsochelseamakingaskfeelhavinglate showtakingcerts to enteramazingfour monthsrulevcanearly closinghospitality sector capacitystillstoneacrossgardamillionairesbodyseparaterevealedclose

Longtail Keyword Density for Irishmirror.ie

KeywordsOccurences
household visits early5
outdoor and indoor5
visits early closing5
hospitality sector capacity5
sector capacity restrictions5
restrictions on outdoor5
indoor events nightclubs5
nightclubs and covid5
certs to enter5
out of hell4
late late show4
met eireann predict4
premises were all3
lifted on saturday3
were all lifted3
see an end3
enter premises were3
end to all3
irelandmeasures on household3
hopeful updatecoronavirus irelandmeasures3
give hopeful updatecoronavirus3
all things covid3
annual leave you3
has been9
late late8
met eireann7
annual leave6
two years5
covid certs5
events nightclubs5
indoor events5
capacity restrictions5
sector capacity5
hospitality sector5
early closing5
visits early5
household visits5
late show4
have been4
bat out4
most restrictions4
hell singer4
turned away4
days after4
love island4
four months4
after she4
garda siochanathe4
eireann predict4
his wife3
hopeful updatecoronavirus3
club hurling3
says she3
star says3
ralf rangnick3
leave you3
all things3
after her3
things covid3
give hopeful3
updatecoronavirus irelandmeasures3
show viewers3
his own3
enter premises3
everything you3
premises were3
covid restrictions3
has shared3
nicola peltz3
taken off3
were all3
after being3
all lifted3
has revealed3
after63
her45
his45
has37
she28
over23
he23
have21
ireland21
new20
covid19
been19
two18
restrictions18
star17
late17
you17
were17
says16
irish15
days15
being15
time15
one14
up14
could14
show14
but14
years13
had13
said12
out12
daughter12
your12
first12
their12
end11
four11
life11
before11
if11
get10
wife10
weather10
which10
snap10
function10
most10
while10
man10
all10
stars9
some9
garda9
home9
singer9
fans9
very9
just9
can9
more9
still9
into9
off9
met8
reveals8
viewers8
dublin8
eireann8
day8
health8
change8
him8
shes8
back7
loaf7
made7
car7
love7
money7
so7
see7
holiday7
birthday7
news7
var7
last7
months7
now7
early7
during7
take7
looks7
death7
my7
people7
dies7
set7
week7
latest7
due7
return7
annual7
all-ireland6
since6
they6
hurling6
there6
upcoming6
may6
bikini6
rte6
lost6
away6
irelands6
travel6
no6
club6
left6
leave6
women6
dates6
prices6
kardashian6
its6
today6
taken6
indoor6
events6
hospitality6
outdoor6
06
each6
amp6
men5
help5
hospital5
crash5
shared5
moment5
island5
throwback5
15
25
former5
would5
body5
amid5
down5
we5
children5
rules5
claimed5
league5
driver5
rule5
second5
not5
got5
expected5
supervalu5
dunnes5
aldi5
secrets5
shares5
hours5
dry5
than5
three5
pandemic5
saturday5
household5
dancing5
ifr5
grim5
enter5
certs5
closing5
visits5
things5
nightclubs5
capacity5
fiance5
sector5
played4
million4
work4
raffle4
scene4
ease4
media4
34
best4
facing4
took4
know4
dont4
many4
shop4
entering4
v4
horror4
need4
lifted4
count4
close4
feel4
running4
house4
mean4
hell4
bat4
little4
results4
series4
winning4
saying4
aged4
win4
big4
well4
clash4
going4
predict4
else4
way4
january4
44
sold4
alcohol4
pinnock4
premises4
model4
earlier4
bank4
actress4
having4
holden4
co4
shows4
find4
54
weight4
lookalike4
wrestlemania4
mum4
skin4
dead4
stone4
michael4
st4
price4
turned4
64
family4
match4
also4
hopeful4
paid4
until4
siochanathe4
incident4
tribute4
issues4
march4
say4
tv4
against4
jones3
university3
welcomed3
child3
never3
few3
millionaires3
williams3
chelsea3
dating3
green3
them3
reportedly3
ask3
tottenham3
announces3
vs3
number3
73
thought3
another3
darragh3
head3
sweet3
ralf3
final3
changes3
place3
needed3
happened3
ago3
rangnick3
chat3
id3
tells3
mostly3
bid3
amazing3
nolan3
tinder3
much3
championship3
pair3
major3
gardai3
taking3
83
birth3
spotted3
gold3
means3
old3
whats3
near3
described3
football3
sharing3
trip3
outside3
around3
list3
post3
should3
forecast3
found3
making3
twins3
year3
both3
husband3
separate3
cars3
seen3
hit3
brooklyn3
half3
cases3
nicola3
peltz3
weeks3
warning3
vaccine3
characters3
donnelly3
actor3
prison3
sons3
different3
opens3
hidden3
kelly3
areas3
married3
ice3
contestant3
released3
katie3
praise3
irelandmeasures3
couple3
legend3
updatecoronavirus3
brian3
give3
proposal3
miss3
93
devastated3
within3
release3
road3
looking3
lidl3
any3
behind3
movie3
only3
coming3
newsfrom3
monday3
expert3
worth3
goal3
announced3
cork3
six3
ever3
tickets3
struggles3
martin3
called3
died3
paul3
go3
tesco3
murphy3
stephen3
reaction3
department3
let3
own3
arrested3
warned3
cant3
break3
plans3
celebrate3
across3
cost3
book3
real3
everything3
us3
top3
shops3
incredible3
union3
euromillions3
advice3
revealed3
ifrcontentdocument3

Who hosts Irishmirror.ie?

Irishmirror.ie Hosting Provider Information

Hosted IP Address:54.228.196.66
Hosted Hostname:ec2-54-228-196-66.eu-west-1.compute.amazonaws
Service Provider:Amazon.com, Inc.
Hosted Country:IrelandIE
Location Latitude:53.344
Location Longitude:-6.26719
Webserver Software:Not Applicable

Is "Amazon.com, Inc." in the Top 10 Hosting Companies?

Name
Percentage
Unknown
21.9161%
GOOGLE
14.0532%
AS-26496-GO-DADDY-COM-LLC
3.4879%
NAMECHEAP-NET
3.1470%
AMAZON-AES
2.2136%
GoDaddy.com, LLC
2.0287%
UNIFIEDLAYER-AS-1
1.9645%
Fara Negar Pardaz Khuzestan
1.6143%
CONFLUENCE-NETWORK-INC
1.4660%
1&1 Internet AG
1.3358%
Amazon.com, Inc.
0.6283%

HTTP Header Analysis for Irishmirror.ie

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Content-Type: text/html;charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Date: Mon, 24 Jan 2022 07:31:08 GMT
Server: nginx
X-Frame-Options: SAMEORIGIN
Content-Security-Policy: frame-ancestors 'self' https://*.cdn.ampproject.org/ https://bing-amp.com/ https://*.tm-aws.com/ https://*.tm-awx.com/;
Access-Control-Allow-Origin: *
Cache-Control: max-age=60
Expires: Mon, 24 Jan 2022 07:40:40 GMT
X-RemovedCookies: YES
X-ProcessESI: yes
X-Cacheable: YES
Content-Encoding: gzip
X-Varnish: 746389602 739055435
X-Served-By: nat-cache302.tm-aws.com
X-Cache-Hits: 6
Via: 1.1 varnish, 1.1 b02c5108645d71e94b66c369c35c449a.cloudfront.net (CloudFront)
Accept-Ranges: bytes
Vary: Accept-Encoding
X-Cache: Miss from cloudfront
X-Amz-Cf-Pop: LHR62-C5
X-Amz-Cf-Id: Fa4QUVnrpHU5V0AtG6PUIOQgVrl7crc-yMAK44yWpQqDM-zKNVWUDQ==

Irishmirror.ie Domain Nameserver Information

HostIP AddressCountry
ns-1453.awsdns-53.org 205.251.197.173
ns-1880.awsdns-43.co.uk 205.251.199.88
ns-205.awsdns-25.com 205.251.192.205
ns-540.awsdns-03.net 205.251.194.28


Need to find out who hosts Irishmirror.ie?


Domain Registration (WhoIs) information for Irishmirror.ie

 Domain Name: irishmirror.ie
Registry Domain ID: 765733-IEDR
Registrar WHOIS Server: whois.weare.ie
Registrar URL: http://www.csccorporatedomains.com/
Updated Date: 2021-04-10T14:09:20Z
Creation Date: 2002-01-04T00:00:00Z
Registry Expiry Date: 2022-03-31T15:21:09Z
Registrar: CSC Domains Inc
Registrar IANA ID: not applicable
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.8009279801
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registry Registrant ID: 317280-IEDR
Registrant Name: MGN Ltd
Registry Admin ID: 37730-IEDR
Registry Tech ID: 37731-IEDR
Registry Billing ID: REDACTED FOR PRIVACY
Name Server: ns-1453.awsdns-53.org
Name Server: ns-1880.awsdns-43.co.uk
Name Server: ns-205.awsdns-25.com
Name Server: ns-540.awsdns-03.net
DNSSEC: unsigned
>>> Last update of WHOIS database: 2022-01-24T07:31:13Z

Websites with Similar Names

Irish-acad.com
Irish Academy – Just another WordPress site
Irish-actors.com
irish-actors.com
Irish-af.com
Create an Ecommerce Website and Sell Online! Ecommerce Software by Shopify
Irish-american.org
Irish American Heritage Center
Irish-art-gallery.com
Lahinch Art Gallery | Irish original art paintings by Irish artists nationwide
Irish-art.net
????????????????????????
Irish-arts.net
irish-arts.net
Irish-bangla.com
porkbun.com | parked domain
Irish-banjo.com
irish-banjo.com | Just another WordPress site

Recently Updated Websites

Texasmetalstructures.com (43 minutes 18 seconds ago.)Thesamuellawfirm.com (1 hour 1 minute ago.)Ram-comparison.com (1 hour 6 minutes ago.)Bidderopt.com (1 hour 43 minutes ago.)Datahubserv.com (1 hour 45 minutes ago.)Dom472.solsijax.ru (1 hour 48 minutes ago.)Plombier-paris-19e.com (1 hour 52 minutes ago.)Alamaula.com.co (1 hour 55 minutes ago.)Vsalon24.ru (1 hour 56 minutes ago.)Ductcleaningalbuquerquenm.com (2 hours 37 minutes ago.)Matribhasha.com (3 hours 9 seconds ago.)Montsaintmichel.com (3 hours 21 minutes ago.)Ricarsalon.com (3 hours 36 minutes ago.)789betsam.com (3 hours 39 minutes ago.)Water-sporter.site (3 hours 46 minutes ago.)Phillipsj.net (3 hours 58 minutes ago.)Areaconvert.com (4 hours 15 minutes ago.)Auctim.com (4 hours 19 minutes ago.)Huayclub.co (4 hours 40 minutes ago.)Heng168.vip (4 hours 52 minutes ago.)Trafficsafety.reviews (4 hours 57 minutes ago.)My-equipment.com (4 hours 57 minutes ago.)Allhotsale.com (5 hours 1 minute ago.)Specagra.lt (5 hours 8 minutes ago.)2048arena.com (5 hours 10 minutes ago.)Pornnit.com (5 hours 10 minutes ago.)Rusticillusions.com (5 hours 24 minutes ago.)Bonsbons.in (5 hours 24 minutes ago.)Ludzie-biznesu.pl (5 hours 46 minutes ago.)Nimbbl.biz (6 hours 9 minutes ago.)

Recently Searched Keywords

der verein (1 second ago.)vn g (2 seconds ago.)made designer quality (4 seconds ago.)auto-moto (4 seconds ago.)undefined var hstatejsonstringifyhistorystate (6 seconds ago.)návštěvní kniha (8 seconds ago.)text below (9 seconds ago.)workingdiv dialogshow ajax (10 seconds ago.)seo jobs (10 seconds ago.)childrens book (10 seconds ago.)fusible interlining (10 seconds ago.)bản tin video (8-14 (11 seconds ago.)elementsgetslideindex (11 seconds ago.)lormont (11 seconds ago.)se supo: otra estrella internacional del fãºtbol se enamorã³ del vino (11 seconds ago.)doivent de tenir (12 seconds ago.)mambo gourmet pizza (13 seconds ago.)Bangla love sms (13 seconds ago.)apkcheatslot.com (13 seconds ago.)orgullo es un (14 seconds ago.)libero gx (14 seconds ago.)www.qclbs.com (14 seconds ago.)vpl3s2 (14 seconds ago.)hautpflege (14 seconds ago.)menupcof payload (15 seconds ago.)black width (16 seconds ago.)french nun sister andre, close to turning 117, knocks down covid-19 (16 seconds ago.)xxx hardcore (18 seconds ago.)rumah di (21 seconds ago.)行业 (22 seconds ago.)