Isbul.net

Website Thumbnail
Checking...
isbul.net: İş İlanları ve Eleman Bulma Sitesi

Safety: Low trust score
Year Founded: 2010
Global Traffic Rank: 128,411
Estimated Worth: $97,800
Last updated:2020-10-29

isbul.net


Domain summary

Domain label
isbul
Domain extension
net
Domain registered:
2010-05-08
Domain updated:
2018-04-09
Global Traffic Rank
128,411
Statvoo Rating
F
Trust Score
Low Trust Score
Estimated worth
$97,800
Estimated daily income
$163
Estimated monthly income
$4,958

Rank summary

How is isbul.net ranked relative to other sites:

Percentage of visits to isbul.net from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Isbul.net registered?
A: Isbul.net was registered 10 years, 6 months, 3 weeks, 3 days, 23 hours, 40 minutes, 59 seconds ago on Saturday, May 8, 2010.
Q: When was the WHOIS for Isbul.net last updated?
A: The WHOIS entry was last updated 2 years, 7 months, 3 weeks, 1 day, 23 hours, 40 minutes, 59 seconds ago on Monday, April 9, 2018.
Q: What are Isbul.net's nameservers?
A: DNS for Isbul.net is provided by the following nameservers:
  • dns1.netlojistik.com.tr
Q: Who is the registrar for the Isbul.net domain?
A: The domain has been registered at FBS INC..
Q: What is the traffic rank for Isbul.net?
A: Isbul.net ranks 128,411 globally on Alexa. Isbul.net has a Low Trust Score, and a Statvoo Rank of F.
Q: How many people visit Isbul.net each day?
A: Isbul.net receives approximately 13,021 visitors and 65,105 page impressions per day.
Q: What IP address does Isbul.net resolve to?
A: Isbul.net resolves to the IPv4 address 85.111.48.83.
Q: In what country are Isbul.net servers located in?
A: Isbul.net has servers located in the Turkey.
Q: What webserver software does Isbul.net use?
A: Isbul.net is powered by webserver.
Q: Who hosts Isbul.net?
A: Isbul.net is hosted by Turk Telekomunikasyon Anonim Sirketi in Istanbul, Istanbul, Turkey, 34134.
Q: How much is Isbul.net worth?
A: Isbul.net has an estimated worth of $97,800. An average daily income of approximately $163, which is roughly $4,958 per month.

Isbul.net Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Isbul.net Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Isbul.net

H1 Headings

1 :
  1. Herkese uygun iş ilanları Isbul.net'te!

H2 Headings

10 :
  1. Pandemi Sürecinde İş Arayanlara Tavsiyeler
  2. İş Hayatında Motivasyonu Artırmak
  3. Kendine Uygun İş Nasıl Bulunur?
  4. 2020 Çocuk Parası Ne Kadar?
  5. E-Ticarette Doğru Bilinen Yanlışlar
  6. Pandemi Sürecinde İş Arayanlara Tavsiyeler
  7. İş Hayatında Motivasyonu Artırmak
  8. Kendine Uygun İş Nasıl Bulunur?
  9. 2020 Çocuk Parası Ne Kadar?
  10. E-Ticarette Doğru Bilinen Yanlışlar

H3 Headings

17 :
  1. HİZMET PERSONELİ
  2. İŞÇİ
  3. YÖNETİCİ
  4. YENİ MEZUN
  5. UZMAN
  6. ENGELLİ
  7. EDİTÖRÜN SEÇTİKLERİ
  8. Sektörel İlanlar
  9. Bölgesel İlanlar
  10. Pozisyona Göre
  11. Etikete Göre
  12. KURUMSAL
  13. ADAY İŞLEMLERİ
  14. FİRMA İŞLEMLERİ
  15. KURUMSAL
  16. ADAY İŞLEMLERİ
  17. FİRMA İŞLEMLERİ

H4 Headings

7 :
  1. Getir Vadi İstanbul Depo
  2. Lore Language Center
  3. Tkc Endüstriyel Ürünler Ltd.Şti.
  4. Sauna Dekor San Tic A.Ş.
  5. Deniz Egece Sağlık Eğitim Ltd. Şti.
  6. İstanbul Lider Kariyer Enstitüsü
  7. Kategorilerine Göre İlanlar

H5 Headings

3 :
  1. İŞ İLANLARI
  2. Mobil Uygulamasını İndirdiniz mi?
  3. Sosyal medyada bizi takip edin!

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

23 :

Google Adsense

:
pub-2678722475982618

Google Analytics

:
UA-31175870-1

Links - Internal

122:
  1. Isbul Üye Ol
    http://isbul.net/kayit?returnurl=%2F
  2. Isbul Firma Üyelik
    https://kurumsal.isbul.net/kayit
  3. Isbul Firma Girişi
    https://kurumsal.isbul.net/
  4. Isbul İş İlanları
    http://isbul.net/is-ilanlari
  5. Isbul İş Rehberi
    http://isbul.net/is-rehberi
  6. http://isbul.net/
    http://isbul.net/
  7. Isbul CV OLUŞTUR
    http://isbul.net/kayit
  8. Isbul ÜYE OL
    http://isbul.net/kayit
  9. Isbul GİRİŞ YAP
    https://kurumsal.isbul.net/
  10. Isbul ÜYE OL
    https://kurumsal.isbul.net/kayit
  11. Isbul ÜCRETSİZ İLAN VER
    https://kurumsal.isbul.net/
  12. Isbul Detaylı Ara
    http://isbul.net/is-ilanlari
  13. Isbul Getir Vadi İstanbul Depo Getir Motokurye Arıyor
    https://www.isbul.net/getir-vadi-istanbul-depo/getir-motokurye-ariyor-is-ilani-237079
  14. Isbul Lore Language Center Branş Öğretmeni
    https://www.isbul.net/lore-language-center/brans-ogretmeni-is-ilani-240036
  15. Isbul Tkc Endüstriyel Ürünler Ltd.Şti. Endüstri Mühendisi
    https://www.isbul.net/tkc-endustriyel-urunler-ltd-sti/endustri-muhendisi-is-ilani-238010
  16. Isbul Sauna Dekor San Tic A.Ş. Mimar
    https://www.isbul.net/sauna-dekor-san-tic-a-s/mimar-is-ilani-239845
  17. Isbul Deniz Egece Sağlık Eğitim Ltd. Şti. Psikolog
    https://www.isbul.net/deniz-egece-saglik-egitim-ltd-sti/psikolog-is-ilani-243566
  18. Isbul İstanbul Lider Kariyer Enstitüsü Sosyal Medya Grafik Tasarımcısı
    https://www.isbul.net/istanbul-lider-kariyer-enstitusu/sosyal-medya-grafik-tasarimcisi-is-ilani-243469
  19. Isbul Hemen İş Bul
    http://isbul.net/is-ilanlari
  20. Isbul Ücretsiz İlan Ver
    https://kurumsal.isbul.net/
  21. Isbul HİZMET PERSONELİİŞ İLANLARI
    http://isbul.net/hizmet-is-ilanlari
  22. Isbul İŞÇİİŞ İLANLARI
    http://isbul.net/isci-is-ilanlari
  23. Isbul YÖNETİCİİŞ İLANLARI
    http://isbul.net/yonetici-is-ilanlari
  24. Isbul YENİ MEZUNİŞ İLANLARI
    http://isbul.net/deneyimsiz-is-ilanlari
  25. Isbul UZMANİŞ İLANLARI
    http://isbul.net/uzman-is-ilanlari
  26. Isbul ENGELLİİŞ İLANLARI
    http://isbul.net/engelli-is-ilanlari
  27. Isbul Satış / Pazarlama
    http://isbul.net/satis-pazarlama-is-ilanlari
  28. Isbul Mali İşler / Finansman
    http://isbul.net/mali-isler-finansman-is-ilanlari
  29. Isbul Mimarlık / İnşaat / Emlak İşleri
    http://isbul.net/mimarlik+insaat-emlak-isleri-is-ilanlari
  30. Isbul Üretim / İmalat
    http://isbul.net/uretim-imalat-is-ilanlari
  31. Isbul Lojistik / Malzeme Yönetimi / Depo
    http://isbul.net/lojistik-malzeme-yonetimi+depo+depo-ambar-antrepo-is-ilanlari
  32. Isbul Eğitim / Öğretim
    http://isbul.net/egitim-danismanligi+egitim-is-ilanlari
  33. Isbul Sağlık / Tıp
    http://isbul.net/saglik-tip-is-ilanlari
  34. Isbul Staj / Yeni Mezun / Part-Time
    http://isbul.net/staj+part-time+deneyimsiz-is-ilanlari
  35. Isbul Sekreter / Yönetici Asistanı
    http://isbul.net/sekreter+yonetici-is-ilanlari
  36. Isbul Mağaza / Perakende / Toptancı
    http://isbul.net/perakendecilik-toptancilik-is-ilanlari
  37. Isbul Reklam / Tanıtım / Tasarım
    http://isbul.net/medya+reklam-is-ilanlari
  38. Isbul Hukuk / Avukat
    http://isbul.net/hukuk-is-ilanlari
  39. Isbul Banka / Finans
    http://isbul.net/banka-finans-is-ilanlari
  40. Isbul İnsan Kaynakları / Yönetim
    http://isbul.net/insan-kaynaklari-is-ilanlari
  41. Isbul Turizm / Otelcilik
    http://isbul.net/turizm-otelcilik-is-ilanlari
  42. Isbul Staj/Yeni Mezun/Part-Time
    http://isbul.net/staj+part-time+deneyimsiz-is-ilanlari
  43. Isbul Sekreter/Yönetici Asistanı
    http://isbul.net/sekreter+yonetici-is-ilanlari
  44. Isbul Mağaza/Perakende/Toptancı
    http://isbul.net/perakendecilik-toptancilik-is-ilanlari
  45. Isbul Reklam/Tanıtım/asarım
    http://isbul.net/medya+reklam-is-ilanlari
  46. Isbul Hukuk/Avukat
    http://isbul.net/hukuk-is-ilanlari
  47. Isbul Mimarlık/İnşaat/Emlak İşleri
    http://isbul.net/mimarlik+insaat-emlak-isleri-is-ilanlari
  48. Isbul Üretim/İmalat
    http://isbul.net/uretim-imalat-is-ilanlari
  49. Isbul Lojistik/Malzeme Yönetimi/ Depo
    http://isbul.net/lojistik-malzeme-yonetimi+depo+depo-ambar-antrepo-is-ilanlari
  50. Isbul Eğitim/Öğretim
    http://isbul.net/egitim-danismanligi+egitim-is-ilanlari
  51. Isbul Sağlık/Tıp
    http://isbul.net/saglik-tip-is-ilanlari
  52. Isbul Hizmet
    http://isbul.net/hizmet-is-ilanlari
  53. Isbul Gıda
    http://isbul.net/gida-is-ilanlari
  54. Isbul İnşaat
    http://isbul.net/insaat-is-ilanlari
  55. Isbul Gayrimenkul - Emlak
    http://isbul.net/gayrimenkul-emlak-is-ilanlari
  56. Isbul Üretim - İmalat
    http://isbul.net/uretim-imalat-is-ilanlari
  57. Isbul Tekstil
    http://isbul.net/tekstil-is-ilanlari
  58. Isbul Tüm Sektörleri Göster
    http://isbul.net/sektorler
  59. Isbul İstanbul - Anadolu
    http://isbul.net/istanbul-anadolu-is-ilanlari
  60. Isbul İstanbul
    http://isbul.net/istanbul-is-ilanlari
  61. Isbul Ankara
    http://isbul.net/ankara-is-ilanlari
  62. Isbul İzmir
    http://isbul.net/izmir-is-ilanlari
  63. Isbul Antalya
    http://isbul.net/antalya-is-ilanlari
  64. Isbul Eskişehir
    http://isbul.net/eskisehir-is-ilanlari
  65. Isbul Tüm Şehirleri Göster
    http://isbul.net/bolgesel-ilanlar
  66. Isbul Sekreter
    http://isbul.net/sekreter-is-ilanlari
  67. Isbul Satış Danışmanı
    http://isbul.net/satis-danismani-is-ilanlari
  68. Isbul Garson
    http://isbul.net/garson-is-ilanlari
  69. Isbul Ön Muhasebe
    http://isbul.net/on-muhasebe-is-ilanlari
  70. Isbul Asistan
    http://isbul.net/asistan-is-ilanlari
  71. Isbul Aktif Satış Elemanı
    http://isbul.net/aktif-satis-elemani-is-ilanlari
  72. Isbul Tüm Pozisyonları Göster
    http://isbul.net/pozisyonlar
  73. Isbul Engelli İlanları
    http://isbul.net/engelli-is-ilanlari
  74. Isbul Staj İlanları
    http://isbul.net/staj-is-ilanlari
  75. Isbul Yarı Zamanlı İlanlar
    http://isbul.net/part-time-is-ilanlari
  76. Isbul Eleman İlanları
    http://isbul.net/eleman-is-ilanlari
  77. Isbul Yönetici İlanları
    http://isbul.net/yonetici-is-ilanlari
  78. Isbul Bügünün İlanları
    http://isbul.net/bugunun-ilanlari-is-ilanlari
  79. Isbul Tüm İlanları Göster
    http://isbul.net/is-ilanlari
  80. http://isbul.net/is-rehberi/tavsiyeler/pandemi-surecinde-is-arayanlara-tavsiyeler
    http://isbul.net/is-rehberi/tavsiyeler/pandemi-surecinde-is-arayanlara-tavsiyeler
  81. Isbul Pandemi Sürecinde İş Arayanlara Tavsiyeler
    http://isbul.net/is-rehberi/tavsiyeler/pandemi-surecinde-is-arayanlara-tavsiyeler
  82. Isbul Devamı İçin Rehbere Git
    http://isbul.net/is-rehberi/tavsiyeler/pandemi-surecinde-is-arayanlara-tavsiyeler
  83. http://isbul.net/is-rehberi/makaleler/is-hayatinda-motivasyonu-artirmak
    http://isbul.net/is-rehberi/makaleler/is-hayatinda-motivasyonu-artirmak
  84. Isbul İş Hayatında Motivasyonu Artırmak
    http://isbul.net/is-rehberi/makaleler/is-hayatinda-motivasyonu-artirmak
  85. Isbul Devamı İçin Rehbere Git
    http://isbul.net/is-rehberi/makaleler/is-hayatinda-motivasyonu-artirmak
  86. http://isbul.net/is-rehberi/makaleler/kendine-uygun-is-nasil-bulunur
    http://isbul.net/is-rehberi/makaleler/kendine-uygun-is-nasil-bulunur
  87. Isbul Kendine Uygun İş Nasıl Bulunur?
    http://isbul.net/is-rehberi/makaleler/kendine-uygun-is-nasil-bulunur
  88. Isbul Devamı İçin Rehbere Git
    http://isbul.net/is-rehberi/makaleler/kendine-uygun-is-nasil-bulunur
  89. http://isbul.net/is-rehberi/makaleler/2020-cocuk-parasi-ne-kadar
    http://isbul.net/is-rehberi/makaleler/2020-cocuk-parasi-ne-kadar
  90. Isbul 2020 Çocuk Parası Ne Kadar?
    http://isbul.net/is-rehberi/makaleler/2020-cocuk-parasi-ne-kadar
  91. Isbul Devamı İçin Rehbere Git
    http://isbul.net/is-rehberi/makaleler/2020-cocuk-parasi-ne-kadar
  92. http://isbul.net/is-rehberi/makaleler/e-ticarette-dogru-bilinen-yanlislar
    http://isbul.net/is-rehberi/makaleler/e-ticarette-dogru-bilinen-yanlislar
  93. Isbul E-Ticarette Doğru Bilinen Yanlışlar
    http://isbul.net/is-rehberi/makaleler/e-ticarette-dogru-bilinen-yanlislar
  94. Isbul Devamı İçin Rehbere Git
    http://isbul.net/is-rehberi/makaleler/e-ticarette-dogru-bilinen-yanlislar
  95. Isbul Tüm Sektörler
    http://isbul.net/sektorler
  96. Isbul İstanbul - Anadolu İş İlanları
    http://isbul.net/istanbul-anadolu-is-ilanlari
  97. Isbul İstanbul İş İlanları
    http://isbul.net/istanbul-is-ilanlari
  98. Isbul Ankara İş İlanları
    http://isbul.net/ankara-is-ilanlari
  99. Isbul İzmir İş İlanları
    http://isbul.net/izmir-is-ilanlari
  100. Isbul Antalya İş İlanları
    http://isbul.net/antalya-is-ilanlari
  101. Isbul Eskişehir İş İlanları
    http://isbul.net/eskisehir-is-ilanlari
  102. Isbul Tüm Bölgeler
    http://isbul.net/bolgesel-ilanlar
  103. Isbul Tüm Pozisyonlar
    http://isbul.net/pozisyonlar
  104. Isbul Tüm İlanlar
    http://isbul.net/is-ilanlari
  105. Isbul Hakkımızda
    http://isbul.net/hakkimizda
  106. Isbul İnsan Kaynakları
    http://isbul.net/insan-kaynaklari
  107. Isbul Kalite Politikası
    http://isbul.net/kalite-politikasi
  108. Isbul Kullanım Koşulları
    http://isbul.net/kullanim-kosullari
  109. Isbul Gizlilik Politikası
    http://isbul.net/gizlilik-politikasi
  110. Isbul Üyelik Sözleşmesi
    http://isbul.net/uyelik-sozlesmesi
  111. Isbul Site Haritası
    http://isbul.net/site-haritasi
  112. Isbul İletişim Bilgileri
    http://isbul.net/iletisim-formu
  113. Isbul Çerez Politikası
    http://isbul.net/cerez-politikasi
  114. Isbul Yeni Üye Kaydı
    http://isbul.net/kayit?returnurl=%2F
  115. Isbul Şifremi Unuttum
    http://isbul.net/#sifremi-unuttum
  116. Isbul SSS
    http://isbul.net/sikca-sorulan-sorular
  117. Isbul Firma Üyeliği
    https://kurumsal.isbul.net/kayit
  118. Isbul İlan Yayınlama
    https://kurumsal.isbul.net/ilan/yayin-islemleri
  119. Isbul Ücretsiz İş İlanı Ver
    http://isbul.net/ucretsiz-is-ilani-ver
  120. Isbul CV Hazırlama
    https://www.isbul.net/cv-hazirlama/
  121. Isbul Kariyer ve İş Fırsatları
    http://isbul.net/isbul-net
  122. Isbul Reklam
    http://isbul.net/reklam

Links - Outbound

6:
  1. https://www.facebook.com/isbul
    https://www.facebook.com/isbul
  2. https://twitter.com/isbulnet
    https://twitter.com/isbulnet
  3. https://www.linkedin.com/company/isbul-net
    https://www.linkedin.com/company/isbul-net
  4. https://www.instagram.com/isbul_net/
    https://www.instagram.com/isbul_net/
  5. https://itunes.apple.com/tr/app/isbul.net-is-ilanlar/id1165353566?mt=8
    https://itunes.apple.com/tr/app/isbul.net-is-ilanlar/id1165353566?mt=8
  6. https://play.google.com/store/apps/details?id=net.isbul.android
    https://play.google.com/store/apps/details?id=net.isbul.android

Links - Outbound (nofollow)

0:

Keyword Cloud for Isbul.net

unreadnotificationsnulldevam in rehberemultiselectcityval if cityvalnedeniylebyk birmultiselectcityvalcityval cityvalreplacewindowlocationhrefneyeniifvarkaynaklarasndaninternet zerindenileif cityvalkimireplace windowlocationhref cityvalalmainputtvaluelanlartmtmgrreplacemultiselectcityval ifcityvalunreadmessagessenereplace replace replacerehbereolalmhemcityvaltostring cityvalreplace replace windowlocationhrefcityval cityvaltostring cityvalgenel birfunctionvar cityval2replace replaceocukancakdahillanvecityvaltostring cityval cityvalreplaceparas nesosyalcityval cityvaltostringolanparas aileninreturn windowlocationhrefmiktarlardaparas ne kadarolarakocuk paras nenull cityval cityvaltostringdevamzaman1kurumucityval cityvalreplace replacebykdolayoucityvalreplacebirinternetbuyecityvalreplace replace replaceyardmherkimi zamancretpandemikadargrecityval null cityvalstanbulgenelocuk parasolduureplace windowlocationhrefdisplayflexparaswindowlocationhref cityvaluygunif cityval nulltotalmessagesbirlikteaileninnull cityvalisilanlaricityval isilanlarimiktarlarihtiyaiin0windowlocationhref cityval isilanlarigiriifirmareturnlanlargnlkzerindenne kadarcityval nullcityvalreplace replacecityvaltostring

Longtail Keyword Density for Isbul.net

KeywordsOccurences
replace replace replace28
devam in rehbere10
multiselect-cityval if cityval4
if cityval null4
cityval null cityval4
null cityval cityvaltostring4
cityval cityvaltostring cityval4
cityvaltostring cityval cityvalreplace4
cityval cityvalreplace replace4
cityvalreplace replace replace4
replace replace windowlocationhref4
replace windowlocationhref cityval4
windowlocationhref cityval -is-ilanlari4
ocuk paras ne4
paras ne kadar4
replace replace32
ocuk paras6
var cityval4
cityval -is-ilanlari4
paras ailenin4
ne kadar4
paras ne4
kimi zaman4
genel bir4
byk bir4
return windowlocationhref4
windowlocationhref cityval4
multiselect-cityval if4
replace windowlocationhref4
cityvalreplace replace4
cityval cityvalreplace4
cityvaltostring cityval4
cityval cityvaltostring4
null cityval4
cityval null4
if cityval4
internet zerinden4
replace36
cityval20
ve17
hem16
var14
bir14
devam12
if12
rehbere10
bu8
paras8
windowlocationhref8
ocuk8
alma7
olarak6
displayflex6
lanlar6
olduu6
ou6
inputtvalue6
zerinden6
ancak5
05
lan5
function5
iin5
her5
olalm4
gnlk4
genel4
ihtiya4
sene4
internet4
miktarlarda4
miktarlar4
kimi4
zaman4
dolay4
ile4
ne4
kadar4
ailenin4
olan4
yardm4
ye4
asndan4
birlikte4
totalmessages4
byk4
14
nedeniyle4
multiselect-cityval4
null4
cityvaltostring4
cityvalreplace4
-is-ilanlari4
return4
stanbul4
gr4
pandemi4
unreadnotifications4
cret3
23
unreadmessages3
uygun3
sosyal3
gre3
dahil3
yeni3
kaynaklar3
tm3
lanlartm3
giriifirma3
kurumu3

Who hosts Isbul.net?

Isbul.net Hosting Provider Information

Hosted IP Address:85.111.48.83
Hosted Hostname:sql.kikiriki.com
Service Provider:Turk Telekomunikasyon Anonim Sirketi
Hosted Country:TurkeyTR
Location Latitude:41.002
Location Longitude:28.9646
Webserver Software:Not Applicable

Is "Turk Telekomunikasyon Anonim Sirketi" in the Top 10 Hosting Companies?

Name
Percentage
GoDaddy.com, LLC
9.5100%
DoD Network Information Center
8.4509%
Google Inc.
2.8338%
Confluence Networks Inc
2.6217%
Amazon.com, Inc.
2.1737%
Namecheap, Inc.
2.1384%
TOT Public Company Limited
1.5665%
1&1 Internet AG
1.5512%
Merit Network Inc.
1.3856%
Unified Layer
1.3043%
Turk Telekomunikasyon Anonim Sirketi
0.0181%

HTTP Header Analysis for Isbul.net

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Cache-Control: private
Content-Type: text/html; charset=utf-8
Content-Encoding: gzip
Vary: Accept-Encoding
X-Frame-Options: SAMEORIGIN
S: 159
Date: Thu, 29 Oct 2020 20:21:51 GMT
Content-Length: 14570

Isbul.net Domain Nameserver Information

HostIP AddressCountry
dns1.netlojistik.com.tr 104.40.181.239


Need to find out who hosts Isbul.net?


Domain Registration (WhoIs) information for Isbul.net

 Domain Name: ISBUL.NET
Registry Domain ID: 1596368804_DOMAIN_NET-VRSN
Registrar WHOIS Server: whois.isimtescil.net
Registrar URL: http://www.isimtescil.net
Updated Date: 2018-04-09T08:04:39Z
Creation Date: 2010-05-08T18:54:03Z
Registry Expiry Date: 2024-05-08T18:54:03Z
Registrar: FBS Inc.
Registrar IANA ID: 1110
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +90.8502000444
Domain Status: ok https://icann.org/epp#ok
Name Server: DNS1.NETLOJISTIK.COM.TR
Name Server: NS0.NETLOJISTIK.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2020-09-22T15:33:40Z

Websites with Similar Names

Isbul.net
isbul.net: İş İlanları ve Eleman Bulma Sitesi
Isbulankara.com
iş bul ankara - STYLE İstihdam Hizmetleri ve İnsan Kaynakları Danışmanlığı
Isbulduk.com
İş Başvuruları ve İş Arayanlar İçin Bilgi Platformu
Isbuldumu.com
Service Unavailable
Isbullsh.it
Home Page - Web Global Solution
Isbulmarobotu.com
DT Is Bulma Robotu
Isbulsam.net
403 Forbidden
Isbulsamsun.com
Samsun ?? ?lanlar?

Recently Updated Websites

1038kun.top (12 seconds ago.)Dientudienlanhbachkhoa24h.top (20 seconds ago.)Beautyyu.top (24 seconds ago.)Sale-mall.xyz (29 seconds ago.)Jtjrbc.xyz (30 seconds ago.)Jolin1992.top (41 seconds ago.)Vekkrl.xyz (43 seconds ago.)Ossc.in (46 seconds ago.)Upforfloorsearch.top (50 seconds ago.)14pw.top (58 seconds ago.)15xn.top (1 minute 2 seconds ago.)Hb166.top (1 minute 3 seconds ago.)14hw.top (1 minute 6 seconds ago.)14qz.top (1 minute 6 seconds ago.)Northuist.space (1 minute 7 seconds ago.)Canakkalekutup.gov.tr (1 minute 9 seconds ago.)Voip-lite.website (1 minute 10 seconds ago.)Lddd1.vip (1 minute 11 seconds ago.)Oceanspray.com.pa (1 minute 11 seconds ago.)12dn.top (1 minute 14 seconds ago.)Sxotc.xyz (1 minute 17 seconds ago.)Antlerenterprises.top (1 minute 17 seconds ago.)16fg.top (1 minute 21 seconds ago.)Beqege.top (1 minute 22 seconds ago.)Depression-symptoms.top (1 minute 22 seconds ago.)Nianav2.top (1 minute 22 seconds ago.)Wujishijie.top (1 minute 25 seconds ago.)Jbstks.xyz (1 minute 25 seconds ago.)12rw.top (1 minute 28 seconds ago.)Maldivesnana.com (1 minute 29 seconds ago.)

Recently Searched Keywords

bid (1 second ago.)browser (14 seconds ago.)reviewratio100optionmultiple choice questionsratio010optionnarrative (15 seconds ago.)often (17 seconds ago.)skruvkapsyler (17 seconds ago.)yaara o yaara lyrics – mehtab virk (23 seconds ago.)yaara (25 seconds ago.)umar lag jaave (26 seconds ago.)umar lag (27 seconds ago.)umar (28 seconds ago.)ulchildren (29 seconds ago.)ul liactive-cat awidgetwpcategorieswidget (30 seconds ago.)ul liactive-cat (31 seconds ago.)ul li ulchildren (33 seconds ago.)ul li ahoverwidgetwpcategorieswidget (33 seconds ago.)tenu meri umar lag jaave lyrics – rahul jain (35 seconds ago.)romantic songs (36 seconds ago.)piel canela lyrics – los panchos, eydie gormé (37 seconds ago.)patriotic songs (38 seconds ago.)old hindi songs (38 seconds ago.)min-width300pxdata-csstve-u-1750bdf22c4tcb-post-list (40 seconds ago.)meri umar lag (43 seconds ago.)meri umar (44 seconds ago.)meri tum ho lyrics – ludo (46 seconds ago.)meri (47 seconds ago.)mere wala jatt lyrics – prem dhillon (48 seconds ago.)mera bhai lyrics – divine (49 seconds ago.)lyricswish.com (49 seconds ago.)lyricswishcom (50 seconds ago.)prijava turista hr (52 seconds ago.)