Jamkicks.net Favicon Jamkicks.net

Jamkicks.net Website Thumbnail
Checking...
JAMKIX - Original Professional Sound for Everyday People JAMKIX– JAMKIX by Air Beats
Low trust score
Add a review Change category Claim this site
It's PRO it's QUALITY, It's SOUND. Join the jam and kick off your beat with JAMKIX The best affordable wireless earbuds you will find on the market. Fully WATERPROOF, 32 HOURS of playing time, 15 minute quick charge, and the BASE is amazing. Made for people like you. On the go, active, beat hungry. Get Jam Kix today


Domain summary

Domain label
jamkicks
Domain extension
net
Domain registered:
2020-06-16
Domain updated:
2020-06-16
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is jamkicks.net ranked relative to other sites:

Percentage of visits to jamkicks.net from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Jamkicks.net registered?
A: Jamkicks.net was registered 4 months, 1 week, 2 days, 22 hours, 35 minutes, 37 seconds ago on Tuesday, June 16, 2020.
Q: When was the WHOIS for Jamkicks.net last updated?
A: The WHOIS entry was last updated 4 months, 1 week, 2 days, 22 hours, 35 minutes, 37 seconds ago on Tuesday, June 16, 2020.
Q: What are Jamkicks.net's nameservers?
A: DNS for Jamkicks.net is provided by the following nameservers:
  • ns65.domaincontrol.com
  • ns66.domaincontrol.com
Q: Who is the registrar for the Jamkicks.net domain?
A: The domain has been registered at GODADDY.COM, LLC.
Q: What is the traffic rank for Jamkicks.net?
A: Jamkicks.net has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Jamkicks.net each day?
A: Jamkicks.net receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Jamkicks.net resolve to?
A: Jamkicks.net resolves to the IPv4 address 184.168.131.241.
Q: In what country are Jamkicks.net servers located in?
A: Jamkicks.net has servers located in the United States.
Q: What webserver software does Jamkicks.net use?
A: Jamkicks.net is powered by Nginx/1.16.1 webserver.
Q: Who hosts Jamkicks.net?
A: Jamkicks.net is hosted by GoDaddy.com, LLC in Arizona, Scottsdale, United States, 85260.
Q: How much is Jamkicks.net worth?
A: Jamkicks.net has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Who hosts Jamkicks.net?

Jamkicks.net Hosting Provider Information

Hosted IP Address:184.168.131.241
Hosted Hostname:ip-184-168-131-241.ip.secureserver.net
Service Provider:GoDaddy.com, LLC
Hosted Country:United StatesUS
Location Latitude:33.6013
Location Longitude:-111.8867
Webserver Software:nginx/1.16.1

Is "GoDaddy.com, LLC" in the Top 10 Hosting Companies?

Name
Percentage

HTTP Header Analysis for Jamkicks.net

Http-Version: 1.1
Status-Code: 301
Status: 301 Moved Permanently
Server: nginx/1.16.1
Date: Tue, 29 Sep 2020 02:16:38 GMT
Content-Type: text/html; charset=utf-8
Transfer-Encoding: chunked
Connection: close
Location: https://jamkix.com

Jamkicks.net Domain Nameserver Information

HostIP AddressCountry
ns65.domaincontrol.com 97.74.102.43
ns66.domaincontrol.com 173.201.70.43


Need to find out who hosts Jamkicks.net?


WhoIs information for Jamkicks.net

 Domain Name: jamkicks.net
Registry Domain ID: 2538839670_DOMAIN_NET-VRSN
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.godaddy.com
Updated Date: 2020-06-16T17:57:49Z
Creation Date: 2020-06-16T17:57:48Z
Registrar Registration Expiration Date: 2021-06-16T17:57:48Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.4806242505
Domain Status: clientTransferProhibited http://www.icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited http://www.icann.org/epp#clientUpdateProhibited
Domain Status: clientRenewProhibited http://www.icann.org/epp#clientRenewProhibited
Domain Status: clientDeleteProhibited http://www.icann.org/epp#clientDeleteProhibited
Registrant Organization: Air Beats LLC
Registrant State/Province: North Carolina
Registrant Country: US
Registrant Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=jamkicks.net
Admin Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=jamkicks.net
Tech Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=jamkicks.net
Name Server: NS65.DOMAINCONTROL.COM
Name Server: NS66.DOMAINCONTROL.COM
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2020-07-28T01:00:00Z

Jamkicks.net Free SEO Report

Website Inpage Analysis for Jamkicks.net

H1 Headings

1 :
  1. JAMKIX by Air Beats

H2 Headings

16 :
  1. Be unstoppable.
  2. Built for workouts. Perfect fit. No Sacrifice.
  3. Waterproof. Never Sacrifice Again.
  4. Built to keep you in the zone.
  5. Made for safety, made for comfort, hands-free calling.
  6. Power through with voice control.
  7. Simply advanced.
  8. Perfect, unbeatable fit.
  9. An Unreal Dynamic Stereo Experience
  10. Join the 10,000+ that have come before you. Do More, Be More, Accomplish More with JAMKIX.
  11. Laser cut, premium quality.
  12. Let's Compare:
  13. What's in the box:
  14. Seamlessly Connect
  15. The Detailed Specs
  16. 360 Guarantee

H3 Headings

6 :
  1. Fully waterproof.
  2. Up to 32 hours of listening time, using the included wireless charging case
  3. Secure-fit earbud
  4. Quickly answer/hang up, pause, or play music.
  5. Easily refuse a call.
  6. Turn on voice assistant.

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

31 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-34825291-10

Links - Internal

15:
  1. Home
    http://jamkicks.net/
  2. Shop Now
    http://jamkicks.net/
  3. Help Center
    http://jamkicks.net/apps/help-center
  4. Track Order
    http://jamkicks.net/apps/trackorder
  5. Log in
    http://jamkicks.net/account/login
  6. No text
    http://jamkicks.net/
  7. Log in
    http://jamkicks.net/account
  8. Cart
    http://jamkicks.net/cart
  9. Learn more
    http://jamkicks.net/products/jamkix-pro
  10. Privacy Policy
    http://jamkicks.net/policies/privacy-policy
  11. Refund Policy
    http://jamkicks.net/policies/refund-policy
  12. Terms of Service
    http://jamkicks.net/policies/terms-of-service
  13. About
    http://jamkicks.net/pages/about
  14. Contact
    http://jamkicks.net/pages/contact
  15. Shipping & Returns
    http://jamkicks.net/pages/shipping-returns

Links - Internal (nofollow)

0:

Links - Outbound

6:
  1. Facebook
    https://www.facebook.com/officialairbeats/
  2. Pinterest
    https://www.pinterest.com/air_beats/
  3. Instagram
    https://www.instagram.com/air.beats.pro/
  4. YouTube
    https://www.youtube.com/channel/UCWAB5Hiy4bqK4qcTGpD81LA
  5. Click here for more information regarding shipping and returns
    https://airbeats.com/pages/shipping-returns
  6. Powered by Shopify
    https://www.shopify.com?utm_campaign=poweredby&utm_medium=shopify&utm_source=onlinestore

Links - Outbound (nofollow)

1:
  1. Powered by Shopify
    https://www.shopify.com?utm_campaign=poweredby&utm_medium=shopify&utm_source=onlinestore

Keyword Cloud for Jamkicks.net

ourjustcordlesswireless connectionanythroughauto importantexperiencenew dategettimepositiontitlequalityf4f4f4200pxscreen and maxwidthurltap the eargoskipjamkix pro4reviewcursorassistantherotitlescreen and minwidthmadeneversacrificebeatsinstagrammusicclosechargingonly screenonlyhandsfreeminheightheadphoneszonehourhourshelpwevarblackheight autoear piececlose esciframeservetechnologypro250pxlaser cut589pxinstagram youtubecallshoptypeopacitywidth 20else ifvoice recognitionsoundf4f4f4 jamkix proisolation1emquicktimearticlesescrelaxproductidnousdsiteheaderlogonotf4f4f4 jamkixblockminwidth1help centerpages0 1bestearshop nowrightmobile deviceyour mobile devicecomesdynamicyour mobileheightfacebook pinterestifmedia onlywireless earphonesearpiecescriptvoice assistantvoicegives youfacebookwidth 100functioncrispleftcutfavoritepause or playimportantusingherotitle fontsizebetterproductschangebuiltrecognitionfontsizeproductwidthgoodrequirediframe positionshippingtopgetnowpinterest instagram youtubeautomedia screenpinterestearphonesheaderitemlogo headerlayoutleftcenterwireless chargingoutwinboomrlmoreheyheaderlayoutleftcenterdevicefitwhiletalkingwaterproofcaseposition relativemaxwidth 589pxpadding50pxtrueairyoubeforehour battery lifedisplayjust tapdisplay blocknew0 1 200pxair beatsperfectchargegivesminwidth 590pxpinterest instagrampieceplay musicbackground f4f4f4intowithout0 importantwaterpausefacebook pinterest instagramflexconnectionmedia only screenlife31 200px2thenstop590px0 250pxhighfrequencycenterdategettime5youtubelisteningmaxwidthmediamobilehour batteryheaderitemlogobackground f4f4f4 jamkiximagecallssound and isolation0play0 0 250pxfocuslaserfirst0 0relativeeasilywater resistantconnectfreeanswerbattery life6workoutupnextwirelesstapbackgroundcomfortyouryour favoritejamkixresistantnamedoelsebatterygood soundscreen

Longtail Keyword Density for Jamkicks.net

KeywordsOccurences
screen and min-width10
media only screen9
screen and max-width6
your mobile device4
pause or play4
facebook pinterest instagram3
pinterest instagram youtube3
0 1 200px3
0 0 250px3
tap the ear3
background f4f4f4 jamkix3
f4f4f4 jamkix pro3
sound and isolation3
hour battery life3
ear piece12
jamkix pro12
only screen9
media only9
min-width 590px9
media screen7
hour battery6
close esc6
wireless charging6
0 06
background f4f4f45
auto important5
max-width 589px5
voice assistant4
your mobile4
water resistant4
your favorite4
wireless connection4
new dategettime4
mobile device4
position relative4
width 1004
herotitle font-size4
gives you4
iframe position4
header-item--logo header-layout--left-center4
battery life4
good sound3
height auto3
f4f4f4 jamkix3
laser cut3
width 203
else if3
wireless earphones3
play music3
voice recognition3
just tap3
air beats3
0 250px3
1 200px3
0 13
instagram youtube3
pinterest instagram3
facebook pinterest3
help center3
shop now3
display block3
0 important3
your24
023
if23
wireless20
jamkix18
ear18
you17
screen16
pro16
media16
important14
voice12
piece12
max-width11
more11
charging10
while10
110
width10
battery10
min-width10
590px9
only9
hour9
auto9
iframe9
experience8
play8
sound7
font-size7
up7
not7
background7
close7
position7
var6
shipping6
favorite6
tap6
fit6
center6
using6
esc6
made6
usd6
required6
top6
height6
earphones5
get5
next5
we5
water5
hands-free5
no5
589px5
f4f4f45
music5
device5
display5
left5
else5
zone5
200px5
250px5
flex5
air5
skip5
answer5
relative4
hey4
assistant4
technology4
before4
talking4
function4
through4
calls4
call4
comfort4
shop4
now4
case4
built4
any4
without4
cut4
articles4
pages4
life4
herotitle4
image4
connection4
24
resistant4
pause4
34
comes4
gives4
our4
44
serve4
then4
go4
crisp4
new4
stop4
easily4
site-headerlogo4
54
mobile4
perfect4
earpiece4
hours4
listening4
time4
1em4
cursor4
out4
header-layout--left-center4
header-item--logo4
cordless4
focus4
free4
dategettime4
recognition4
better3
laser3
charge3
productid3
change3
url3
title3
opacity3
products3
63
black3
type3
product3
quick3
isolation3
waterproof3
padding3
good3
right3
min-height3
50px3
high3
workout3
just3
script3
never3
facebook3
help3
pinterest3
instagram3
youtube3
relax3
block3
true3
first3
best3
headphones3
winboomrl3
into3
name3
dynamic3
sacrifice3
connect3
frequency3
do3
quality3
review3
beats3

Jamkicks.net Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Jamkicks.net is a scam?

Websites with Similar Names

Jamkicks.net
JAMKIX - Original Professional Sound for Everyday People JAMKIX– JAMKIX by Air Beats
Jamkitchencatering.com
The Jam Kitchen | Catering jam packed with passion

Recently Updated Websites

Clarioncabinetry.com 2 seconds ago.Cadesign.ie 2 seconds ago.Lazyedge.com 3 seconds ago.Tianfabanjia.com 3 seconds ago.Robbysrooter.com 3 seconds ago.Thecatalystleaderbook.com 4 seconds ago.360gac.com 5 seconds ago.Mediamoji.com 5 seconds ago.Mrstarlton.com 5 seconds ago.Bicielettriche.com 5 seconds ago.Lxcng.net 5 seconds ago.Fauquierent.net 5 seconds ago.Outlierengland.com 6 seconds ago.Medicinalexpress.com 7 seconds ago.Yaliah.com 7 seconds ago.Zheziwei.com 7 seconds ago.Keyringer.com 7 seconds ago.Fcome.tv 7 seconds ago.Wzosen.com 7 seconds ago.Unews.utah.edu 8 seconds ago.Clothesmake.com 9 seconds ago.Shangrilaus.com 9 seconds ago.Manuelangeldiaz.com 9 seconds ago.Jewishchildren.com 9 seconds ago.Seeblue.com 10 seconds ago.Rowlandgarrett.com 10 seconds ago.Haidaomao.com 10 seconds ago.Bedaya-news.com 11 seconds ago.Mlamidwest.org 11 seconds ago.Soprolife.com 12 seconds ago.