Cloud Object Storage | Store & Retrieve Data Anywhere | Amazon Simple Storage Service (S3)

Safety: Low trust score
Year Founded: 01
Global Traffic Rank: 327,974
Estimated Worth: $9,720
Category: This site has not been categorized yet



Domain summary

Last updated
2021-05-20
Domain label
jdsports-client-resources
Domain extension
co.uk
Domain registered:
01-Mar-2017
Domain updated:
01-Feb-2021
Global Traffic Rank
327,974
Statvoo Rating
G
Trust Score
Low Trust Score
Estimated worth
$9,720
Estimated daily income
$27
Estimated monthly income
$821

Frequently Asked Questions (FAQ)

Q: When was Jdsports-client-resources.co.uk registered?
A: Jdsports-client-resources.co.uk was registered 4 years, 4 months, 4 weeks, 1 day, 2 hours, 6 minutes, 25 seconds ago on Wednesday, March 1, 2017.
Q: When was the WHOIS for Jdsports-client-resources.co.uk last updated?
A: The WHOIS entry was last updated 5 months, 4 weeks, 1 day, 2 hours, 6 minutes, 25 seconds ago on Monday, February 1, 2021.
Q: What are Jdsports-client-resources.co.uk's nameservers?
A: DNS for Jdsports-client-resources.co.uk is provided by the following nameservers:
  • a1-160.akam.net
  • a14-67.akam.net
  • a20-64.akam.net
  • a4-65.akam.net
  • a7-66.akam.net
  • a9-67.akam.net
Q: Who is the registrar for the Jdsports-client-resources.co.uk domain?
A: The domain has been registered at Nominet UK.
Q: What is the traffic rank for Jdsports-client-resources.co.uk?
A: Jdsports-client-resources.co.uk ranks 327,974 globally on Alexa. Jdsports-client-resources.co.uk has a Low Trust Score, and a Statvoo Rank of G.
Q: How many people visit Jdsports-client-resources.co.uk each day?
A: Jdsports-client-resources.co.uk receives approximately 3,011 visitors and 9,033 page impressions per day.
Q: What IP address does Jdsports-client-resources.co.uk resolve to?
A: Jdsports-client-resources.co.uk resolves to the IPv4 address .
Q: In what country are Jdsports-client-resources.co.uk servers located in?
A: Jdsports-client-resources.co.uk has servers located in the .
Q: What webserver software does Jdsports-client-resources.co.uk use?
A: Jdsports-client-resources.co.uk is powered by Server webserver.
Q: Who hosts Jdsports-client-resources.co.uk?
A: Jdsports-client-resources.co.uk is hosted by Unknown in .
Q: How much is Jdsports-client-resources.co.uk worth?
A: Jdsports-client-resources.co.uk has an estimated worth of $9,720. An average daily income of approximately $27, which is roughly $821 per month.

Jdsports-client-resources.co.uk Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Jdsports-client-resources.co.uk Free SEO Report

Website Inpage Analysis for Jdsports-client-resources.co.uk

H1 Headings

2 :
  1. Amazon S3
  2. Benefits

H2 Headings

6 :
  1. How it works - S3 features
  2. Use cases
  3. Case studies
  4. What's new with S3
  5. S3 blog posts
  6. Ready to get started?

H3 Headings

23 :
  1. Object storage built to store and retrieve any amount of data from anywhere
  2. Industry-leading performance, scalability, availability, and durability
  3. Wide range of cost-effective storage classes
  4. Unmatched security, compliance, and audit capabilities
  5. Easily manage data and access controls
  6. Query-in-place and process on-request
  7. Most supported cloud storage service
  8. You can add your own code to process data retrieved from S3 before returning it to an application
  9. Gain organization-wide visibility into storage usage, activity trends, and receive actionable recommendations
  10. Optimize storage costs with S3 Intelligent-Tiering
  11. Easily manage access for shared data sets with S3 Access Points
  12. Manage tens to billions of objects at scale with S3 Batch Operations
  13. Block all public access to your S3 data, now and in the future
  14. Backup and restore
  15. Disaster recovery (DR)
  16. Archive
  17. Data lakes and big data analytics
  18. Hybrid cloud storage
  19. Cloud-native applications
  20. Learn About AWS
  21. Resources for AWS
  22. Developers on AWS
  23. Help

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

13 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

100:

Links - Internal (nofollow)

0:

Links - Outbound

51:

Links - Outbound (nofollow)

0:

Keyword Cloud for Jdsports-client-resources.co.uk

gettingintooverviewthroughworkstoragepermissionsaws marketplacestorage classbucketaccess pointsaccountbasedintelligenttieringvpccustomautomaticallylearningeasyadd yourqueryaccess tieradd your ownfuturetoolsmanagement consoleensureblock public accessavailabilitycan usestoreget starteddrperformancechangesstorage costsavailableaws lambdasetsblogsbillions of objectsbackup and restoreyour owntherelensstandardwithinnetworkifyou can useaccessweb servicesconsecutive daysworkss3 get requestshelp youyou can alsodata lakes3 batch operationsdurabilitystorage servicemanagementcan alsooperationsqueryinplaceupwebcan addpubliclambda you cananalyticsownaccess tierspartnerdata analyticss3 access pointsdashboardeachlearnhavegetwithoutcustomersaddtimes3 block publicamazon web servicesmeetaws clouds3 storage classesbuiltaws accountbig data analyticsrunaccess pointorganizationwidebetweenown codecloudnativepatternscopiescentercreaterestoreamazon s3apnvisits3 glacierorganizationwide visibilityarchive accesswhichstorage classespointsyour dataconsecutivecompliances3 resources0getting startedcloud storagepage to learnproductsmeansmachinesuchpublic accessvisit the s3pleasesigntrendsglacieramazoncleanhtmlentityitss3 consoleyou cancan add yourblockdata setsbigyousets3 object lambdausingobjectssecureobject storagemodifyshared data setsusagelambdasettingsstoringrecoverydata protectionlearn moreaccessedsupportmore s3process datacontrolsvisibility intoresourcesprocesslakesactivity trendsconsole you canoutpostsstartedconfiguresolutionspartnersinsightstiersstorage usageapplicationsdayspagestoresmobiledeliversmore about s3definedeepraquoany amountdeep archiveaccess patternsimprovepricingjobs3 bucketconsole youdirectlymakes3servicesarchivelambda youseebuildingviewclassnorequestpointorganizationwide visibility intobig datayour own codedata lakesbillionsalltiers3 batchcompliance requirementsmappedfieldscreateddateleveldata in amazonvisibilityfrequentclassesdata accessbackupalsoawssharedyourcloudrequestss3 getacross yourfeaturesamountobject lambdametricsdeveloperuseget requestsprivates3 blockinfrastructurepartner networkbucketscapabilitiescodehybridconsoleprotectfirstlearn more s3documentationenvironmentprotectionordersecuritycostmanageserviceamount of datamachine learningcloudnative applicationss3 dataapplicationrequirementsanybackyour s3casedatanews3 intelligenttieringscalespecificamazon webtransfereasilymarketplacehelps3 storages3 objectreturnedstorage lenspoliciesobjectgatewayobject storage usageamps3 storage lensaws storages3 accessactivityusage and activityonpremisesbatch operationsif ifdesignedapplysingleshared datas3 console youlakeotherblock publicbatchuse s3replicationmorecontrolcostsacrossrecommendationscan

Longtail Keyword Density for Jdsports-client-resources.co.uk

KeywordsOccurences
block public access9
s3 batch operations9
s3 access points8
s3 storage lens8
s3 block public7
you can also7
s3 object lambda6
backup and restore5
data in amazon5
s3 get requests3
amazon web services3
console you can3
add your own3
s3 console you3
visit the s33
page to learn3
learn more s33
your own code3
organization-wide visibility into3
can add your3
lambda you can3
usage and activity3
object storage usage3
billions of objects3
more about s33
you can use3
s3 storage classes3
big data analytics3
amount of data3
shared data sets3
amazon s333
you can25
public access15
learn more15
s3 storage14
access points11
s3 object10
batch operations10
block public9
s3 batch9
storage lens9
s3 access8
your data8
s3 glacier8
data lake8
s3 intelligent-tiering7
if if7
can also7
s3 block7
storage classes6
object storage6
storage costs6
access patterns6
object lambda6
storage usage5
data protection5
storage service5
s3 data5
access tier5
activity trends4
your own4
cloud storage4
shared data4
console you4
access point4
access tiers4
archive access4
cloud-native applications4
your s34
partner network4
aws marketplace4
data access4
compliance requirements4
can use4
web services3
any amount3
s3 console3
s3 bucket3
more s33
getting started3
management console3
deep archive3
consecutive days3
data sets3
aws cloud3
aws storage3
aws account3
machine learning3
get started3
big data3
data lakes3
lambda you3
help you3
storage class3
use s33
organization-wide visibility3
visibility into3
aws lambda3
across your3
s3 resources3
can add3
add your3
data analytics3
own code3
s3 get3
get requests3
process data3
amazon web3
s3139
data84
access68
aws60
storage51
amazon47
you41
your35
can34
objects23
more22
learn21
if19
object18
all16
raquo16
applications16
use15
public15
up12
lambda12
using11
points11
archive11
block11
batch10
lake10
operations10
cloud10
also10
management10
console10
create10
services9
security9
lens9
store9
account9
get8
on-premises8
glacier8
costs8
across8
analytics8
service8
bucket7
manage7
intelligent-tiering7
each7
cost7
into7
meet7
compliance7
restore7
scale7
support6
features6
tier6
resources6
requirements6
without6
automatically6
application6
no6
patterns6
transfer6
center6
point6
started6
cleanhtmlentity6
any6
code6
blogs6
classes6
process5
customers5
protection5
view5
private5
tiers5
apn5
partner5
changes5
solutions5
delivers5
network5
backup5
easily5
replication5
shared5
usage5
activity5
cloud-native5
protect5
tools5
outposts5
permissions5
performance5
set4
trends4
own4
help4
run4
have4
requests4
recommendations4
metrics4
modify4
organization-wide4
level4
recovery4
apply4
specific4
time4
documentation4
capabilities4
query4
new4
its4
job4
configure4
controls4
building4
marketplace4
durability4
pricing4
vpc4
which4
sets4
case3
please3
mappedfieldscreateddate3
back3
learning3
single3
through3
machine3
insights3
days3
dr3
work3
deep3
control3
policies3
consecutive3
accessed3
ensure3
frequent3
hybrid3
there3
future3
buckets3
order3
between3
page3
visit3
gateway3
class3
first3
amount3
03
designed3
big3
lakes3
such3
means3
availability3
request3
built3
copies3
mobile3
developer3
getting3
see3
overview3
dashboard3
amp3
settings3
products3
stores3
available3
directly3
works3
partners3
custom3
returned3
add3
improve3
standard3
query-in-place3
infrastructure3
define3
visibility3
storing3
billions3
other3
within3
easy3
make3
secure3
environment3
based3
web3
sign3

Who hosts Jdsports-client-resources.co.uk?

Jdsports-client-resources.co.uk Hosting Provider Information

Hosted IP Address:Not Applicable
Hosted Hostname:Not Applicable
Service Provider:Unknown
Hosted Country:Not Applicable
Location Latitude:Not Applicable
Location Longitude:Not Applicable
Webserver Software:Server

Is "Unknown" in the Top 10 Hosting Companies?

Name
Percentage
GOOGLE
17.2088%
Unknown
5.0138%
AS-26496-GO-DADDY-COM-LLC
4.3256%
NAMECHEAP-NET
3.6268%
AMAZON-AES
2.7254%
GoDaddy.com, LLC
2.4825%
UNIFIEDLAYER-AS-1
2.3319%
Fara Negar Pardaz Khuzestan
1.9947%
CONFLUENCE-NETWORK-INC
1.7092%
1&1 Internet AG
1.6708%

HTTP Header Analysis for Jdsports-client-resources.co.uk

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Content-Type: text/html;charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Server: Server
Date: Thu, 20 May 2021 13:24:24 GMT
x-amz-rid: 7TMVS8RKTREGVZZX0JWX
X-Frame-Options: SAMEORIGIN
X-Content-Type-Options: nosniff
x-amz-id-1: 7TMVS8RKTREGVZZX0JWX
Last-Modified: Tue, 27 Apr 2021 22:20:23 GMT
Content-Security-Policy-Report-Only: default-src 'self' data: https://a0.awsstatic.com; connect-src 'self' http://amazonwebservicesinc.tt.omtrdc.net https://112-tzm-766.mktoresp.com https://a0.awsstatic.com https://a0.p.awsstatic.com https://amazonwebservices.d2.sc.omtrdc.net https://api.regional-table.region-services.aws.a2z.com https://api.us-west-2.prod.pricing.aws.a2z.com https://aws-mktg-site-hz-beta.integ.amazon.com https://b0.p.awsstatic.com https://c0.b0.p.awsstatic.com https://calculator.aws https://d1.awsstatic.com https://d1fgizr415o1r6.cloudfront.net https://d3borx6sfvnesb.cloudfront.net https://dc.ads.linkedin.com https://fls-na.amazon.com https://googleads.g.doubleclick.net https://i18n-string.us-west-2.prod.pricing.aws.a2z.com https://is-it-down.com https://prod.log.shortbread.aws.dev https://prod.tools.shortbread.aws.dev https://s0.awsstatic.com https://spot-bid-advisor.s3.amazonaws.com https://view-stage.us-west-2.prod.pricing.aws.a2z.com https://view-staging.us-east-1.prod.plc1-prod.pricing.aws.a2z.com https://www.youtube-nocookie.com; font-src 'self' data: https://a0.awsstatic.com https://fonts.gstatic.com; frame-src 'self' https://c0.b0.p.awsstatic.com https://calculator.aws https://www.youtube-nocookie.com; img-src 'self' data: https://a0.awsstatic.com https://amazonwebservices.d2.sc.omtrdc.net https://aws-mktg-csds-alpha.integ.amazon.com https://d1.awsstatic.com https://d2908q01vomqb2.cloudfront.net https://d36cz9buwru1tt.cloudfront.net https://dc.ads.linkedin.com https://fls-na.amazon.com https://googleads.g.doubleclick.net https://i.ytimg.com https://i1.ytimg.com https://img.youtube.com https://marketingplatform.google.com https://media.amazonwebservices.com https://p.adsymptotic.com https://px.ads.linkedin.com https://www.google.com https://www.linkedin.com https://yt3.ggpht.com; media-src 'self' https://a0.awsstatic.com https://d1le29qyzha1u4.cloudfront.net https://d2908q01vomqb2.cloudfront.net https://media.amazonwebservices.com; script-src 'self' 'unsafe-eval' 'unsafe-inline' http://amazonwebservicesinc.tt.omtrdc.net https://a0.awsstatic.com https://googleads.g.doubleclick.net https://is-it-down.amazon.com https://static.doubleclick.net https://www.google.com https://www.gstatic.com; style-src 'self' 'unsafe-inline' https://a0.awsstatic.com; report-uri https://prod-us-west-2.csp-report.marketing.aws.dev/submit
Content-Encoding: gzip
Vary: accept-encoding,Content-Type,Accept-Encoding,X-Amzn-CDN-Cache,X-Amzn-AX-Treatment,User-Agent
X-Cache: Miss from cloudfront
Via: 1.1 c31d49af55fff364fbd11e21a32f7fcb.cloudfront.net (CloudFront)
X-Amz-Cf-Pop: LHR3-C1
X-Amz-Cf-Id: h2nA3jsGReudRyTl92bwaMV-NUo86IMpIUAebeTCX3FfUfDvw_zEJQ==

Jdsports-client-resources.co.uk Domain Nameserver Information

HostIP AddressCountry
a1-160.akam.net 193.108.91.160
a14-67.akam.net 184.26.161.67
a20-64.akam.net 95.100.175.64
a4-65.akam.net 72.246.46.65
a7-66.akam.net 23.61.199.66
a9-67.akam.net 184.85.248.67


Need to find out who hosts Jdsports-client-resources.co.uk?


Domain Registration (WhoIs) information for Jdsports-client-resources.co.uk

 Domain name:
jdsports-client-resources.co.uk

Data validation:
Nominet was able to match the registrant's name and address against a 3rd party data source on 11-Dec-2019

Registrar:
Namesco Limited [Tag = NAMESCO]
URL: http://www.names.co.uk

Relevant dates:
Registered on: 01-Mar-2017
Expiry date: 01-Mar-2022
Last updated: 01-Feb-2021

Registration status:
Registered until expiry date.

Name servers:
a1-160.akam.net
a14-67.akam.net
a20-64.akam.net
a4-65.akam.net
a7-66.akam.net
a9-67.akam.net

WHOIS lookup made at 14:24:24 20-May-2021

--
This WHOIS information is provided for free by Nominet UK the central registry
for .uk domain names. This information and the .uk WHOIS are:

Copyright Nominet UK 1996 - 2021.

You may not access the .uk WHOIS or use any data from it except as permitted
by the terms of use available in full at https://www.nominet.uk/whoisterms,
which includes restrictions on: (A) use of the data for advertising, or its
repackaging, recompilation, redistribution or reuse (B) obscuring, removing
or hiding any or all of this notice and (C) exceeding query rate or volume
limits. The data is provided on an 'as-is' basis and may lag behind the
register. Access may be withdrawn or restricted at any time.

Websites with Similar Names

Jdspodcast.com
Jerseys & Dress Shirts – Podcast
Jdspork.com
JDS Porkasaurus – BBQ
Jdsport.online
jdsport.online
Jdsportfolio.com
Jerry Smilack
Jdsportingphotography.com.au
JD Sporting Photography – Sports Photography
Jdsportonline.com
JD Sport | Quality Apparel Since 1989!
Jdsports-client-resources.co.uk
Cloud Object Storage | Store & Retrieve Data Anywhere | Amazon Simple Storage Service (S3)
Jdsports-fr.com
jdsports-fr.com

Recently Updated Websites

Realtorsbocaraton.com (8 seconds ago.)Btcmanager.org (15 seconds ago.)Kimberlymynhierphotography.com (17 seconds ago.)Allstarshauling.com (21 seconds ago.)Pointer-wildlife-art.co.uk (25 seconds ago.)Notengopagina.net (27 seconds ago.)Derstandard.com (28 seconds ago.)Stream-lisp.org (28 seconds ago.)Commdevelopmentbank.com (29 seconds ago.)Yayuvip4822.app (30 seconds ago.)Mrclick.shop (31 seconds ago.)Civculture.net (37 seconds ago.)Flyhanger.com (39 seconds ago.)Thevacicollection.com (42 seconds ago.)Icaiml.com (46 seconds ago.)Truiwt.com (48 seconds ago.)Taidoullc.com (48 seconds ago.)Studioattune.com (48 seconds ago.)Socialploy.com (50 seconds ago.)Aalogisticacontrol.com (50 seconds ago.)Lilithgold.com (53 seconds ago.)Drainxpress.com (1 minute 1 second ago.)Swekredit.com (1 minute 1 second ago.)Administrator.net.in (1 minute 2 seconds ago.)Gandobags.com (1 minute 6 seconds ago.)Ai-syst.com (1 minute 6 seconds ago.)Gobravegirl.com (1 minute 8 seconds ago.)Thegeekwing.com (1 minute 9 seconds ago.)Adventure-thru.com (1 minute 12 seconds ago.)Hfalati.com (1 minute 18 seconds ago.)

Recently Searched Keywords

auen (2 seconds ago.)çayırova belediye başkanı bünyamin çiftçi yardım kampanyasını kendisi takip ediyor (3 seconds ago.)du cadre 75 (3 seconds ago.)dönel kavşağa görsel dokunuşdönel kavşağa görsel dokunuş (4 seconds ago.)15em font-family (5 seconds ago.)details x2192 (7 seconds ago.)bloodhoundtokenizerswhitespacevalue querytokenizer bloodhoundtokenizerswhitespace (7 seconds ago.)diamant  (9 seconds ago.)dönel kavşağa görsel dokunuşdönel kavşağa görsel dokunuş (14 seconds ago.)cursos virtuales (19 seconds ago.)ali oshinskie (21 seconds ago.)bloodhoundtokenizerswhitespacevalue querytokenizer bloodhoundtokenizerswhitespace (31 seconds ago.)trinidad and tobago (32 seconds ago.)经济 (38 seconds ago.)propensity (40 seconds ago.)cuntyparadise (45 seconds ago.)misdaadmap (48 seconds ago.)kompetanse (1 minute 3 seconds ago.)tonga (1 minute 11 seconds ago.)19.11.2018 (1 minute 25 seconds ago.)employee classifications (1 minute 26 seconds ago.)prawnych (1 minute 30 seconds ago.)ooo 100 (1 minute 32 seconds ago.)nokta gayrimenkul (1 minute 33 seconds ago.)nasba (1 minute 34 seconds ago.)65-70 cm çıt çıt saç - 12 (1 minute 35 seconds ago.)sich merkzettel kingston (1 minute 36 seconds ago.)anfragen (1 minute 37 seconds ago.)e-tech meaning (1 minute 38 seconds ago.)tokelau (1 minute 39 seconds ago.)