Jeans at click

Allt mode som passar till jeans

Category: This site has not been categorized yet


Domain summary

SafetyLow trust score
Year Founded
2014
Global Traffic Rank
Unknown
Estimated Worth
$9
Last updated
2021-09-17
Domain label
jeans-at-click
Domain extension
se
Domain registered:
2014-03-25
Domain updated:
2021-09-17
Domain expires:
2022-03-25
Statvoo Rating
I
Estimated daily income
$0
Estimated monthly income
$0

Frequently Asked Questions (FAQ)

Q: When was Jeans-at-click.se registered?
A: Jeans-at-click.se was registered 8 years, 3 months, 1 day, 5 hours, 17 minutes, 3 seconds ago on Tuesday, March 25, 2014.
Q: When was the WHOIS for Jeans-at-click.se last updated?
A: The WHOIS entry was last updated 9 months, 1 week, 2 days, 5 hours, 17 minutes, 3 seconds ago on Friday, September 17, 2021.
Q: What are Jeans-at-click.se's nameservers?
A: DNS for Jeans-at-click.se is provided by the following nameservers:
  • a.ns14.net
  • b.ns14.net
  • c.ns14.net
  • d.ns14.net
Q: Who is the registrar for the Jeans-at-click.se domain?
A: The domain has been registered at NIC-SE.
Q: What is the traffic rank for Jeans-at-click.se?
A: Jeans-at-click.se has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Jeans-at-click.se each day?
A: Jeans-at-click.se receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Jeans-at-click.se resolve to?
A: Jeans-at-click.se resolves to the IPv4 address 178.73.231.232.
Q: In what country are Jeans-at-click.se servers located in?
A: Jeans-at-click.se has servers located in the Sweden.
Q: What webserver software does Jeans-at-click.se use?
A: Jeans-at-click.se is powered by Nginx/1.13.6 webserver.
Q: Who hosts Jeans-at-click.se?
A: Jeans-at-click.se is hosted by GleSYS AB in Sweden.
Q: How much is Jeans-at-click.se worth?
A: Jeans-at-click.se has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Jeans-at-click.se Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Jeans-at-click.se Free SEO Report

Website Inpage Analysis for Jeans-at-click.se

H1 Headings

1 :
  1. Jeans at click

H2 Headings

17 :
  1. Allt mode som passar till jeans
  2. Något snyggt på toppen
  3. Välja rätt
  4. Accessorera snyggt med dina jeans
  5. Guld och silver klär upp din outfit
  6. Rätt solglasögon skapar attityd
  7.  Experimentera med skorna
  8. Streetmodet 2020
  9. Jeansmodeller som passar
  10. En annorlunda gåva
  11. Modetrender 2020
  12. En sommar med extra allt
  13. Klassiska material och stilar
  14. Det klassiska jeans modet
  15. Omvårdnad för kläder och jeans
  16. Kom in i de gamla favoritjeansen
  17. Matcha med jeans

H3 Headings

15 :
  1. Framhäv och förstärk
  2. Byxor för den storvuxne
  3. Jeans i olika färger
  4. Bra kvalité
  5. Tvätta inte jeansen
  6. Tips för andra plagg
  7. Fettsugning
  8. Du kan inte punktförbränna
  9. Styrketräning
  10. Uppklädd
  11. Bling bling
  12. Skorna
  13. Sök
  14. Senaste inläggen
  15. Arkiv

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

11 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

26:

Links - Internal (nofollow)

0:

Links - Outbound

18:

Links - Outbound (nofollow)

0:

Keyword Cloud for Jeans-at-click.se

menhuvudbonadnoch jeansjeans mode commentsskornaextra4helavarfrjeansenkpaidagjeans shemmellanjeans postedmngapostedunderutankan varagrnamen detgematcha medgr attkombinera3r ngot0passarstreethaaccessoreravenett par jeansgamla favoritjeansenr ettducomments off1s kan manfr klderstorakan passata5rttvalkldersinadu trnartrendfebruaryolikaklder ochmodejeansmodellerngrapassar tillrfrgermnga andraska duallavadtill jeansdin outfitbaragamlajeansdelutkommed dina jeansfettdu anvnderdet inteseptembersom kanskedu skafrnattkan manvissafrgaguldintresseefteraccessoarer tills kan detmodetrender 2020uppklddblirolika frgerdet klassiska jeansstilarframnrhalsbandfinns detmatcha med jeansmed dinaskorjeans jeanscommentslrenfr attmodettshirtr detdu villmerstreetmodet 2020januarys lngefrmstharsnyggt p toppenfettsugninghar ettskavillom dusomsom passarjufr att fatt dukanmode comments offmodetrenderklassiska jeansngot snyggt pkommerfinnsmaterialhanddelarkvalitdetalltidmed ettutan attanvnds finnsfestfavoritjeansenanvndernyadigett pargllerjeansmodeller som passarbstadet rjeansmodeller somgvagermassor medoch detskapakan detmayoctoberfr klder ochvad sompassagrsnyggts r detsom dudennangot snyggtfrvljaklassiska jeans modetoutfitmassorinomfstiltill jeansenvljertvttaettjeans ochkepsarngot somstorlekdenatt fstreetmodettrnarjeans modedet klassiskapardu harmatchaaccessorera snyggt medvissalltandramed litemed jeansuppsmyckenliteklassiskaanvndavilkendettahrlite mersilveravannatbyxornr dumotnedomsnyggdrheltoch det rrnnyqemycketvarasom manosskanskes kanbland annatstrreatt detelleromvrdnad fr kldersnyggt med dinahittarbliomvrdnadmedlngekan duomvrdnad frpjeans rlngres rmode somplaggenjeans modetannorlunda gvadet grtillfllenklder och jeansvarittilljeansen ochhllasnyggt pngotsnyggt medklackskordindina jeansflerademdet finnspar jeansplaggvidaccessoareratt gesoffut ochhittamusklernabraposted by rnnyqe2plagg somman kanblandbdeaccessorera snyggtannorlundakollamjligtdinamanklartdu kanfettcellershortss finns dettarandra plaggatt hittajunetoppenarmbandkroppenintekan jubehverocksdochp toppengven omsigbortvisnyggadet r ettmode commentsstthoodies

Longtail Keyword Density for Jeans-at-click.se

KeywordsOccurences
posted by rnnyqe10
mode comments off9
jeans mode comments6
s kan det4
ett par jeans4
jeansmodeller som passar4
ngot snyggt p3
klder och jeans3
fr klder och3
omvrdnad fr klder3
det r ett3
klassiska jeans modet3
det klassiska jeans3
fr att f3
s kan man3
s finns det3
snyggt p toppen3
s r det3
och det r3
med dina jeans3
snyggt med dina3
accessorera snyggt med3
matcha med jeans3
fr att16
ett par14
s kan11
kan du11
comments off10
det r10
om du10
med jeans9
som passar9
mode comments9
nr du8
s r7
jeans mode7
att det6
finns det6
ngot som5
det finns5
kan det5
och det5
r det5
till jeansen5
r ett5
bland annat4
par jeans4
annorlunda gva4
lite mer4
att hitta4
jeans s4
att du4
att f4
jeans r4
du kan4
utan att4
med dina4
och jeans4
du ska4
gr att4
din outfit4
snyggt med4
har ett4
dina jeans4
matcha med4
jeansmodeller som4
klassiska jeans3
kan passa3
gamla favoritjeansen3
s finns3
andra plagg3
klder och3
fr klder3
omvrdnad fr3
kan ju3
olika frger3
modetrender 20203
kan man3
ska du3
jeans och3
det klassiska3
massor med3
plagg som3
jeans modet3
det gr3
som man3
mode som3
man kan3
men det3
passar till3
till jeans3
accessoarer till3
jeans jeans3
ngot snyggt3
snyggt p3
p toppen3
med lite3
som du3
accessorera snyggt3
jeans posted3
kan vara3
du anvnder3
med ett3
s lnge3
r ngot3
vad som3
jeansen och3
ven om3
det inte3
du har3
streetmodet 20203
att ge3
ut och3
mnga andra3
du vill3
som kanske3
du trnar3
och90
att70
du69
jeans69
som69
det63
med61
r60
fr56
kan51
s42
p40
ett35
av32
till28
eller25
om25
inte24
man22
020
har19
ska17
mode16
par15
ngot15
den14
din14
men14
jeansen13
vi12
andra12
nr12
lite12
finns12
vara12
plagg12
dina12
mer11
kanske11
passar11
frn11
snyggt11
accessoarer11
off10
rtt10
posted10
klder10
comments10
rnnyqe10
gr10
annat9
upp9
ven9
mnga8
alla8
sig8
vad8
kommer8
olika8
n7
extra7
outfit7
hela7
ut7
dig7
kroppen7
klassiska7
vill7
grna7
stil7
behver7
ju7
vlja7
allt6
utan6
mot6
tvtta6
hitta6
dem6
october6
bde6
bland6
anvnder6
bara6
ocks6
passa6
nya6
alltid6
ta5
gamla5
frger5
strre5
bli5
f5
kombinera5
mycket5
anvnda5
ngra5
hr5
blir5
dr5
d5
january5
15
vljer5
gva4
inom4
june4
vid4
matcha4
val4
jeansmodeller4
storlek4
idag4
24
annorlunda4
varit4
vilken4
flera4
skor4
material4
lnge4
bort4
mellan4
accessorera4
lren4
lngre4
street4
oss4
34
modet4
stilar4
fettceller3
stora3
klackskor3
hand3
fett3
bsta3
kvalit3
february3
favoritjeansen3
kom3
modetrender3
smycken3
tar3
del3
plaggen3
g3
shorts3
may3
musklerna3
ned3
snygg3
fettsugning3
omvrdnad3
anvnd3
hlla3
tillfllen3
trnar3
massor3
skorna3
intresse3
ger3
armband3
mjligt3
silver3
guld3
bra3
delar3
skapa3
helt3
kepsar3
klart3
gller3
fram3
varfr3
huvudbonad3
43
toppen3
uppkldd3
snygga3
hem3
halsband3
streetmodet3
stt3
ha3
september3
frga3
sina3
kpa3
byxor3
vissa3
fest3
under3
viss3
t-shirt3
efter3
hittar3
kolla3
detta3
hoodies3
frmst3
denna3
trend3
ge3
53

Who hosts Jeans-at-click.se?

Jeans-at-click.se Hosting Provider Information

Hosted IP Address:178.73.231.232
Hosted Hostname:178.73.231.232
Service Provider:GleSYS AB
Hosted Country:SwedenSE
Location Latitude:59.3247
Location Longitude:18.056
Webserver Software:nginx/1.13.6

Is "GleSYS AB" in the Top 10 Hosting Companies?

Name
Percentage
Unknown
21.6445%
GOOGLE
14.1050%
AS-26496-GO-DADDY-COM-LLC
3.4726%
NAMECHEAP-NET
3.1524%
AMAZON-AES
2.2226%
GoDaddy.com, LLC
2.0265%
UNIFIEDLAYER-AS-1
1.9734%
Fara Negar Pardaz Khuzestan
1.6251%
CONFLUENCE-NETWORK-INC
1.4696%
AMAZON-02
1.3660%
GleSYS AB
0.0025%

HTTP Header Analysis for Jeans-at-click.se

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx/1.13.6
Date: Fri, 17 Sep 2021 17:06:17 GMT
Content-Type: text/html; charset=utf-8
Last-Modified: Fri, 04 Jun 2021 03:29:36 GMT
Transfer-Encoding: chunked
Connection: keep-alive
Vary: Accept-Encoding
ETag: W/"60b99e20-b7cb"
X-Frame-Options: SAMEORIGIN
X-XSS-Protection: 1; mode=block
X-Content-Type-Options: nosniff
Content-Encoding: gzip

Jeans-at-click.se Domain Nameserver Information

HostIP AddressCountry
a.ns14.net 62.116.159.231
b.ns14.net 217.160.113.32
c.ns14.net 195.34.161.195
d.ns14.net 74.208.254.231


Need to find out who hosts Jeans-at-click.se?


Domain Registration (WhoIs) information for Jeans-at-click.se

 # Copyright (c) 1997- The Swedish Internet Foundation.
# All rights reserved.
# The information obtained through searches, or otherwise, is protected
# by the Swedish Copyright Act (1960:729) and international conventions.
# It is also subject to database protection according to the Swedish
# Copyright Act.
# Any use of this material to target advertising or
# similar activities is forbidden and will be prosecuted.
# If any of the information below is transferred to a third
# party, it must be done in its entirety. This server must
# not be used as a backend for a search engine.
# Result of search for registered domain names under
# the .se top level domain.
# This whois printout is printed with UTF-8 encoding.
#
state: active
domain: jeans-at-click.se
holder: IX18490289u
admin-c: -
tech-c: -
billing-c: -
created: 2014-03-25
modified: 2021-03-15
expires: 2022-03-25
transferred: 2021-03-15
nserver: a.ns14.net
nserver: b.ns14.net
nserver: c.ns14.net
nserver: d.ns14.net
dnssec: unsigned delegation
registry-lock: unlocked
status: ok
registrar: InterNetX GmbH

Websites with Similar Names

Jeans-711.com
Félicitations ! Votre domaine a bien été créé chez OVH !
Jeans-at-click.pl
Jeans at Click – Mój obuwniczy świat
Jeans-at-click.se
Jeans at click
Jeans-beauty.com
Oscar Poole
Jeans-bg.com
WWW.JEANS-BG.COM - Дънки, джинси, дънки - големи размери online
Jeans-brands.com
Jeans Brands - Jeans-Brands.com
Jeans-burger.com
Jean's Burger – Kurzfilm
Jeans-center.pl
Jeansy - Spodnie Jeansowe Męskie Wrangler, Lee - Sklep Internetowy Online i Outlet | JeansCenter
Jeans-champion.com
HOME | Jeans 2

Recently Updated Websites

Ibd.senado.gob.mx (7 seconds ago.)Premierstructural.biz (8 seconds ago.)Falcolnpay.org (9 seconds ago.)Gregor.com (11 seconds ago.)Glampolish.com.au (13 seconds ago.)Oliverwilkins.com (13 seconds ago.)Ybvip1537.app (14 seconds ago.)Mitoproject.com (14 seconds ago.)Thedailychaser.com (17 seconds ago.)Rockswalkingtours.com.au (18 seconds ago.)Bruederschmidt.at (19 seconds ago.)Andreasnorman.se (20 seconds ago.)Lejardyn.com (24 seconds ago.)Bigfoottoursbonaire.com (26 seconds ago.)Mednotion.com (28 seconds ago.)Americancarting.com (29 seconds ago.)Fsu.nz (30 seconds ago.)Irishpolyglot.com (30 seconds ago.)Dietcar.com (30 seconds ago.)Olivaloe.shop (31 seconds ago.)De.mydirtyhobby.com (34 seconds ago.)Alexcorbi.com (36 seconds ago.)Chefsinsight.com (36 seconds ago.)Ipickfootball.com (37 seconds ago.)Cencogan.com (37 seconds ago.)0510baidu.com (37 seconds ago.)Jaleng.us (42 seconds ago.)Nxs.fyi (44 seconds ago.)Savemauinow.com (44 seconds ago.)Imtcdl.ac.in (44 seconds ago.)

Recently Searched Keywords

ofd.ru (1 second ago.)harborsunset (1 second ago.)meridien hotel (1 second ago.)por gravedad (1 second ago.)webcam italia (1 second ago.)september 2019 (2 seconds ago.)librusec скачать (2 seconds ago.)if asnav (2 seconds ago.)bdrip 720p (2 seconds ago.)diplomacy key (3 seconds ago.)coolmath4kids base ten blocks (3 seconds ago.)malinska (3 seconds ago.)密封的机器 (4 seconds ago.)humanidades estudiar (4 seconds ago.)habits that can (4 seconds ago.)power crazy radio (5 seconds ago.)slider_pv36.jpg (5 seconds ago.)הוראות קבע ביטוח לאומי (6 seconds ago.)my favorites (6 seconds ago.)services overview (6 seconds ago.)nausea meaning in urdu (6 seconds ago.)charades meaning (6 seconds ago.)minimal effort dental plans – an affordable alternative (6 seconds ago.)agroclimatologia (7 seconds ago.)maccabi (7 seconds ago.)candidate may (7 seconds ago.)softtek glassdoor (7 seconds ago.)wash for babies (7 seconds ago.)you 1200 (8 seconds ago.)pigouvian (8 seconds ago.)