Justmac.info Website Information

Justmac.info has a Low Trust Score, a Statvoo Rank of H, an Alexa Rank of 674,714, a Majestic Rank of 0, a Domain Authority of 34% and is not listed in DMOZ.

Justmac.info is hosted by CloudFlare, Inc. in California, San Francisco, United States, 94107.
Justmac.info has an IP Address of 162.159.245.120 and a hostname of 162.159.245.120.

The domain justmac.info was registered 1 decade 5 years 4 weeks ago by , it was last modified 201 decades 9 years 4 days ago and currently is set to expire 201 decades 9 years 4 days ago.


Whois information for justmac.info

Full Whois Lookup for Justmac.info Whois Lookup

Domain Name: JUSTMAC.INFO
Registry Domain ID: D6384894-LRMS
Registrar WHOIS Server: whois.psi-usa.info
Registrar URL: http://www.psi-usa.info
Updated Date: 2017-09-14T22:24:03Z
Creation Date: 2004-09-14T15:02:18Z
Registry Expiry Date: 2018-09-14T15:02:18Z
Registrar Registration Expiration Date:
Registrar: PSI-USA, Inc. dba Domain Robot
Registrar IANA ID: 151
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +49.94159559482
Reseller:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: autoRenewPeriod https://icann.org/epp#autoRenewPeriod
Registry Registrant ID: C20796759-LRMS
Registrant Name: Thomas Lohner
Registrant Organization:
Registrant Street: Neukoellner Strasse 220a
Registrant City: Berlin
Registrant State/Province: Berlin
Registrant Postal Code: 12357
Registrant Country: DE
Registrant Phone: +49.3028875640
Registrant Phone Ext:
Registrant Fax: +49.3028875650
Registrant Fax Ext:
Registrant Email: Login to show email
Admin ID: C20796759-LRMS
Admin Name: Thomas Lohner
Admin Organization:
Admin Street: Neukoellner Strasse 220a
Admin City: Berlin
Admin State/Province: Berlin
Admin Postal Code: 12357
Admin Country: DE
Admin Phone: +49.3028875640
Admin Phone Ext:
Admin Fax: +49.3028875650
Admin Fax Ext:
Admin Email: Login to show email
Tech ID: C19464234-LRMS
Tech Name: Domain Master
Tech Organization: yais.net
Tech Street: Neukoellner Strasse 220a
Tech City: Berlin
Tech State/Province: DE
Tech Postal Code: 12357
Tech Country: DE
Tech Phone: +49.3028875640
Tech Phone Ext:
Tech Fax: +49.3028875650
Tech Fax Ext:
Tech Email: Login to show email
Billing ID: C20796759-LRMS
Billing Name: Thomas Lohner
Billing Organization:
Billing Street: Neukoellner Strasse 220a
Billing City: Berlin
Billing State/Province: Berlin
Billing Postal Code: 12357
Billing Country: DE
Billing Phone: +49.3028875640
Billing Phone Ext:
Billing Fax: +49.3028875650
Billing Fax Ext:
Billing Email: Login to show email
Server: CARL.NS.CLOUDFLARE.COM
Name Server: EMILY.NS.CLOUDFLARE.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of WHOIS database: 2017-09-20T12:44:18Z

Who hosts Justmac.info?

Justmac.info Web Server Information

Hosted IP Address:162.159.245.120
Hosted Hostname:162.159.245.120
Service Provider:CloudFlare, Inc.
Hosted Country:United StatesUS
Location Latitude:37.7697
Location Longitude:-122.3933
Webserver Software:Not Applicable

HTTP Header Analysis for Justmac.info

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: cloudflare-nginx
Date: Mon, 21 Sep 2015 15:11:18 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
X-Powered-By: PHP/5.6.11-1 deb.sury.org~trusty 1
X-GENERATED: 2015-09-21 17:11:18
CF-RAY: 2296b3af2469062e-LHR
Content-Encoding: gzip


Need to find out who hosts Justmac.info?

Justmac.info Free SEO Report

Website Inpage Analysis for Justmac.info

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:pub-7212461903644646
Google Analytics:Not Applicable

Keyword Cloud for Justmac.info

ego1411 macosfuumlr iphone ipadios 11 dievielefunktionen aumlnderungenfunktionennumbersveroumlffentlichtdownloadinfos wwdc 2017golem permalink 20092017sieht25supgradeapple diemit iosdeineshattvneuehellip 20092017vonkeynote ioskeynote ios 11denababerproblemewatchos 4ios 11 fuumlrhierdieserdasxwissenneue ioshabender neuenpagesio11 die2017 liveticker zurzeigenersteadsbygoogle windowadsbygoogletvos 11minivon ioskeynotemit demios 11 frapfs das neueapfs dasbetriebssystemdiebringtapple hat5gehtdem iphonemaclife permalinkapple zeigtmacshellipnochdeszudemaumlnderungenneuerungenauf demhellipmactechnews permalinkapple watchlivetickergesternnicht mehr11 frnurfuumlr iphoneadsbygoogle windowadsbygoogle pushtestiphone ampzur keynote iosgoogle ioallesbeinebennbsp nbspversiontrackerdiesessolltendateisystem deines6plusfuumlrvomdiesemit derupdate11 ist daipad funktionenidauch diewatchmitnbspversiontrackerfastpermalink googleauch1ampiphonesjetzt apfskamerachromegolemdas neue iosuhr maclifedreierscheinenstoreuhr golem2017 livetickerihrneue dateisystemallerdingsappsmacdas pixelbook9lassenvon ios 11dem neuenipadpermalink 20092017sie daspermalink 19092017kommenmacos hiersind1936 uhralleiphone ipadeinbereitswwdc 2017sofortmehrswatchosdownloadinfosseinbismanmactechnewsabendvarsichpermalink iosausaufsollversionsowievorface idliveticker zurbis zuamp ipadzumerstenappdassistmacshellip 19092017nichtschnellzur keynoteiphone 5sneue dateisystem deinesnetios 11 macoskoumlnnenmaclife permalink applemit ios 11stehtsierrastelltmacnews permalinkpushwwdc 2017 livetickererhoumlhtfuumlr iphone ampuntereinem11 fuumlr iphonewurdemacos hier ampwie dassoleistung8siebaldkannfaceeinmaldateisystemswiftdaruumlbernachuhr macnews7neuensondernzurmacnewsiphones und macshellipeinehat apple1936 uhr macnewsdie beideniphone amp ipad11weiterlesenthemen ios 11neuesauf ios 11googlehellipamp jetztbeideniosjetzt apfs daswennkoumlnnteiphone xwieuhr maclife permalinkprobleme mitaumlnderungen downloadinfosuhr macnews permalinkadsbygoogleuhr golem permalink19092017 1936aumlnderungen downloadinfos wwdcgoogle home minibekanntinstallationdem1012vielipad funktionen aumlnderungenheutewerdenmactechnews permalink 20092017bekommenwindowadsbygoogledas neue dateisystemdateisystem deines iphonesdamitios 11mit einemoderdownloadinfos wwdcfuumlr dieapple eingoogle homeapplegooglehellip 20092017wwdcuhrdannauf iosmicrosoftbeimamp jetzt apfszeigt11 fuumlruhr mactechnews13mbpermalinkschonhomebei dergolem permalinktouchapp storeeinenimmacnews permalink iosapplesdas updateuumlber dieuhr mactechnews permalink19092017 1936 uhrhier amp3wirfuumlr dasmacosgooglesollenfunktionen aumlnderungen downloadinfosaktualisiertpermalink appleiphonejetztesapfsproganznbspdas neuedeines iphonesauf einnunfrzupermalink ios 110jahrweiterlesenthemen iosamwirdnutzerpixelbookersten rundgangist das11 macos hiermaclifemit dem neuenrundganghome miniuumlberdownloadweiterlesenthemenios 11 istdateneinerosumhier amp jetztliveticker zur keynoteelektroautotvos4bietetist daeinige11 istkundenihnenvideosmacos sierraderapple tvdaamp ipad funktionenwindowadsbygoogle push

Longtail Keyword Density for Justmac.info

KeywordsOccurences
uhr golem permalink17
uhr maclife permalink12
permalink ios 1111
uhr macnews permalink9
uhr mactechnews permalink9
von ios 118
11 fuumlr iphone7
ios 11 fuumlr7
keynote ios 116
ios 11 macos6
2017 liveticker zur6
wwdc 2017 liveticker6
11 macos hier6
liveticker zur keynote6
zur keynote ios6
amp jetzt apfs6
neue dateisystem deines6
dateisystem deines iphones6
iphones und macshellip6
das neue dateisystem6
apfs das neue6
hier amp jetzt6
download-infos wwdc 20176
jetzt apfs das6
macos hier amp6
aumlnderungen download-infos wwdc6
funktionen aumlnderungen download-infos6
fuumlr iphone amp6
iphone amp ipad6
amp ipad funktionen6
ipad funktionen aumlnderungen6
macnews permalink ios4
golem permalink 200920174
adsbygoogle windowadsbygoogle push4
google home mini4
ios 11 ist4
mit ios 114
19092017 1936 uhr3
weiterlesenthemen ios 113
ios 11 die3
ios 11 fr3
1936 uhr macnews3
maclife permalink apple3
das neue ios3
mactechnews permalink 200920173
auf ios 113
fuumlr iphone ipad3
mit dem neuen3
11 ist da3
ios 1158
golem permalink17
uhr golem17
das neue16
uhr maclife12
maclife permalink12
permalink ios11
fuumlr iphone10
von ios10
mactechnews permalink9
macnews permalink9
uhr mactechnews9
uhr macnews9
11 fuumlr8
mit dem7
permalink 200920177
hat apple7
app store7
amp jetzt6
amp ipad6
iphone amp6
jetzt apfs6
neue dateisystem6
auch die6
ipad funktionen6
tvos 116
deines iphones6
apfs das6
funktionen aumlnderungen6
2017 liveticker6
wwdc 20176
macos hier6
keynote ios6
zur keynote6
liveticker zur6
download-infos wwdc6
aumlnderungen download-infos6
dateisystem deines6
hier amp6
11 macos6
ist das5
permalink apple5
watchos 45
macshellip 190920175
dem iphone5
google home5
11 ist5
iphone 5s4
home mini4
fuumlr die4
dem neuen4
11 fr4
das update4
ersten rundgang4
nbsp nbspversiontracker4
adsbygoogle windowadsbygoogle4
windowadsbygoogle push4
mit der4
face id4
mit ios4
apple ein4
ist da4
hellip 200920174
weiterlesenthemen ios3
19092017 19363
11 die3
permalink 190920173
auf dem3
apple tv3
apple zeigt3
apple watch3
1936 uhr3
permalink google3
probleme mit3
bis zu3
auf ios3
neue ios3
iphone ipad3
uumlber die3
das pixelbook3
mit einem3
google io3
googlehellip 200920173
apple hat3
bei der3
sie das3
der neuen3
auf ein3
apple die3
fuumlr das3
nicht mehr3
macos sierra3
wie das3
iphone x3
die beiden3
074
nbsp64
ios62
uhr62
die58
das56
der51
permalink50
apple47
fuumlr46
144
mit37
iphone31
von29
ein29
ist27
google25
neue25
auch24
auf24
dem22
hat19
im17
den17
neuen17
217
golem17
amp17
wie16
ipad15
zu15
sie14
nicht13
zur12
sich12
wird12
so12
maclife12
noch11
einem11
311
eine11
funktionen11
macos10
keynote10
werden10
des10
fr10
jetzt9
mactechnews9
aus9
bei9
unter9
wir9
macnews9
koumlnnen8
apps8
vor8
mehr8
48
einen8
es8
app7
am7
hier7
version7
nach7
drei7
nutzer7
nur7
57
store7
veroumlffentlicht7
update7
id7
oder7
aumlnderungen6
download-infos6
wwdc6
kann6
uumlber6
einer6
liveticker6
aber6
apfs6
macshellip6
tvos6
mac6
iphones6
deines6
dateisystem6
swift6
daten5
bringt5
zeigt5
x5
sind5
diese5
zum5
haben5
download5
da5
watchos5
hellip5
heute5
neues5
fast5
home5
alles5
man5
ihr5
ab5
nun5
soll5
upgrade5
um5
betriebssystem5
apples5
alle5
koumlnnte4
bald4
kommen4
64
push4
74
plus4
gestern4
sein4
wenn4
sofort4
mini4
5s4
touch4
face4
jahr4
adsbygoogle4
lassen4
windowadsbygoogle4
84
pages4
bis4
sierra4
pixelbook4
rundgang4
tv4
kunden4
einige4
94
var4
dann4
nbspversiontracker4
ersten4
test4
damit4
wissen4
103
erhoumlht3
ihnen3
113
wurde3
weiterlesenthemen3
sieht3
abend3
ego3
leistung3
stellt3
123
bietet3
sowie3
installation3
watch3
133
kamera3
beiden3
zudem3
dieser3
neben3
dieses3
aktualisiert3
143
ganz3
s3
bekommen3
videos3
io3
schnell3
zeigen3
microsoft3
geht3
net3
googlehellip3
pro3
einmal3
chrome3
sollten3
elektroauto3
vom3
beim3
sondern3
allerdings3
bekannt3
daruumlber3
erscheinen3
numbers3
viel3
erste3
sollen3
viele3
bereits3
schon3
probleme3
mb3
steht3
os3
dass3
neuerungen3

What are the nameservers for justmac.info?

Justmac.info Domain Nameserver Information

HostIP AddressCountry
dana.ns.cloudflare.com 173.245.58.105United States United States
dave.ns.cloudflare.com 173.245.59.109United States United States

Justmac.info Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Justmac.info is a scam?