Create & Sell Online Courses & Coaching With Kajabi

Safety: Low trust score
Year Founded: 2021
Global Traffic Rank: Unknown
Estimated Worth: $9

Kajabi is an all-in-one business platform to create and scale your knowledge business. Try Kajabi for free with a 14-day trial today.



Domain summary

Last updated
2021-04-08
Domain label
kajabi
Domain extension
co
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is kajabi.co ranked relative to other sites:

Percentage of visits to kajabi.co from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Kajabi.co registered?
A: Kajabi.co was registered 1 week, 2 days, 23 hours, 43 minutes, 54 seconds ago on Thursday, April 8, 2021.
Q: When was the WHOIS for Kajabi.co last updated?
A: The WHOIS entry was last updated 1 week, 2 days, 23 hours, 43 minutes, 54 seconds ago on Thursday, April 8, 2021.
Q: What are Kajabi.co's nameservers?
A: DNS for Kajabi.co is provided by the following nameservers:
  • ns1.dnsimple.com
  • ns2.dnsimple.com
  • ns3.dnsimple.com
  • ns4.dnsimple.com
Q: Who is the registrar for the Kajabi.co domain?
A: The domain has been registered at .CO Internet, S.A.S..
Q: What is the traffic rank for Kajabi.co?
A: Kajabi.co has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Kajabi.co each day?
A: Kajabi.co receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Kajabi.co resolve to?
A: Kajabi.co resolves to the IPv4 address 3.225.89.236.
Q: In what country are Kajabi.co servers located in?
A: Kajabi.co has servers located in the United States.
Q: What webserver software does Kajabi.co use?
A: Kajabi.co is powered by Openresty webserver.
Q: Who hosts Kajabi.co?
A: Kajabi.co is hosted by Cogent Communications in Virginia, Ashburn, United States, 20149.
Q: How much is Kajabi.co worth?
A: Kajabi.co has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Kajabi.co Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Kajabi.co Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Kajabi.co

H1 Headings

5 :
  1. Everything you need for your knowledge business. All in one place.
  2. Everything you need for your knowledge business. All in one place.
  3. Your business before Kajabi...
  4. But your business after Kajabi...
  5. Here’s what you get with every single Kajabi plan.

H2 Headings

6 :
  1. Your business before Kajabi...
  2. But your business after Kajabi…
  3. Here’s what you get with every single Kajabi plan.
  4. Kajabi is everything you need, no plugins or integrations required
  5. We’re fanatical about your success
  6. Since we’re both serious about your business, let’s make it official. Try Kajabi free for 14 days.

H3 Headings

15 :
  1. Integrated subscriptions, courses, and digital products
  2. Everything in one place
  3. Get paid on your terms
  4. Smarter business moves with better data
  5. Beautiful emails, now faster than ever
  6. The fastest way to create a fully-integrated page
  7. Automations you’ll actually use (and enjoy)
  8. Track your leads like a real business
  9. Customer relationships, transformed and monetized
  10. Your digital products and community, anywhere
  11. Real People. Real Results.
  12. 24/7 Support
  13. Vibrant Community
  14. Kajabi University
  15. Start your 14-day free trial

H4 Headings

1 :
  1. Maximize your success with Kajabi Access

H5 Headings

0 :

H6 Headings

16 :
  1. Ross Grant
  2. Jenine Dilts Bayman
  3. Mel Abraham
  4. Amy Porterfield
  5. Brendon Burchard
  6. Michelle Helmers Lagaly
  7. Brian J. Dixon
  8. Haley Burkhead
  9. Dirk van Reenen
  10. Monica Hershaft
  11. Chris Luck
  12. Sarah-Jane Walls
  13. Product
  14. Company
  15. Help
  16. Contact Us

Total IFRAMEs

1 :

Total Images

91 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Kajabi.co

0cookies14 daysstart freeutmmediumstringifiedattributesnew2yourwickedsourceplatformfreewickedkeyword varplacewickedterm wickedkeyword varyouvefactoryexpert amp kajabimsclid wickedsource wickedmediumwickedsource wickedmedium wickedcampaignlearningyouhrefneedeifwickedkeywordpluginsknowledgeproductsutmstringcustomersexpert amputmcontent utmkeyword gclidwickedmedium wickedcampaign wickedidkajabieverything youfree triallearnwickedid wickedterm wickedkeywordwickedcampaigntoolsexpertbusinessutmcampaign utmtermvaluenowcreateparamregisteredinmoduleloader015usewickedidreturnworksutmkeyword gclidnamefewyour customersrgba255 255 255triallearnutmsource utmmediumgclid msclid wickedsourceeveryattributesattributenamerealmarketingstringkeyattributesrgba255 255utmterm utmcontent utmkeywordattributesexpires06smyaudiencecoach255 015wickedmedium wickedcampaignthenone placeyour websitepeoplegclidutmcampaignwhyhauyour knowledgexidurlstringwickedcampaign wickedidcustomerwickedterm wickedkeywordmoremsclidvideofree for 14justyou canwickedid wickedtermso you canutmsourcekeyutmmedium utmcampaign utmtermallyou can focustogether255 255betterhttpskajabiwistiacommedias0dw93d7zh9msclid wickedsourcewebsiteutmcampaign utmterm utmcontentcookies varfocusno pluginscoach ampaccess3intogrowingenergybuiltyou needus12pxvaronline14 daysstarttransparentcommunityourthiscookiegrowing youreaseso youutmkeyword255 255 015makewidth 06s easeemailknowledge businessurl1utmmedium utmcampaigngclid msclidfunctioneverythingutmcontenteverything you needonergba255buildyour businesswickedcampaign wickedid wickedtermcatchheightdaysstart freecanwindowcookiesapihavegetsinglewickedmediumwidthwidth 06swickedsource wickedmediumsodaysstartsellutmkeyword gclid msclidutmterm utmcontentcoach amp kajabiutmsource utmmedium utmcampaignincomingtruetypeoftry06s easeif typeofexpiresutmcontent utmkeywordcookienodecodeuricomponentutmtermctobjamp kajabiwickedtermcatch eresultampintegrationsif keycan focus

Longtail Keyword Density for Kajabi.co

KeywordsOccurences
everything you need4
you can focus4
wickedid wickedterm wickedkeyword3
wickedcampaign wickedid wickedterm3
wickedmedium wickedcampaign wickedid3
wickedsource wickedmedium wickedcampaign3
msclid wickedsource wickedmedium3
gclid msclid wickedsource3
utmkeyword gclid msclid3
utmcontent utmkeyword gclid3
utmterm utmcontent utmkeyword3
utmmedium utmcampaign utmterm3
utmcampaign utmterm utmcontent3
utmsource utmmedium utmcampaign3
255 255 0153
rgba255 255 2553
width 06s ease3
coach amp kajabi3
so you can3
expert amp kajabi3
14 daysstart free3
free for 143
wickedterm wickedkeyword var3
your business10
free triallearn9
you can9
amp kajabi9
you need5
knowledge business4
everything you4
can focus4
if typeof4
utmkeyword gclid3
utmsource utmmedium3
utmmedium utmcampaign3
utmcampaign utmterm3
utmterm utmcontent3
utmcontent utmkeyword3
wickedmedium wickedcampaign3
gclid msclid3
msclid wickedsource3
wickedsource wickedmedium3
wickedcampaign wickedid3
wickedid wickedterm3
wickedterm wickedkeyword3
wickedkeyword var3
if key3
rgba255 2553
catch e3
expert amp3
no plugins3
one place3
your website3
growing your3
14 daysstart3
daysstart free3
so you3
255 0153
coach amp3
your customers3
width 06s3
06s ease3
your knowledge3
255 2553
cookies var3
your57
var51
kajabi28
you27
if23
free18
business17
key14
cookie14
function14
013
no12
return11
amp9
name9
triallearn9
everything9
result9
can9
one8
all8
just8
more8
need7
attributes7
get7
community7
cookies7
16
customers6
build6
utmstring6
width6
knowledge5
email5
create5
attributesexpires5
new5
true5
expires5
together5
marketing5
products5
value5
api5
thiscookie4
decodeuricomponent4
platform4
stringifiedattributes4
us4
tools4
try4
typeof4
transparent4
registeredinmoduleloader4
ctobj4
real4
stringkey4
now4
built4
energy4
better4
into4
single4
then4
use4
24
place4
height4
so4
httpskajabiwistiacommedias0dw93d7zh94
video4
focus4
integrations3
plugins3
attributesattributename3
e3
learning3
href3
utmsource3
utmmedium3
utmcontent3
utmcampaign3
wickedterm3
urlstring3
sell3
online3
param3
incoming3
wickedkeyword3
wickedid3
utmterm3
wickedcampaign3
wickedmedium3
wickedsource3
msclid3
gclid3
utmkeyword3
catch3
make3
few3
rgba2553
coach3
audience3
expert3
daysstart3
people3
our3
my3
have3
12px3
06s3
ease3
every3
url3
0153
growing3
33
whyhau3
youve3
xid3
factory3
works3
website3
windowcookies3
customer3
access3

Who hosts Kajabi.co?

Kajabi.co Hosting Provider Information

Hosted IP Address:3.225.89.236
Hosted Hostname:ec2-3-225-89-236.compute-1.amazonaws.com
Service Provider:Cogent Communications
Hosted Country:United StatesUS
Location Latitude:39.0481
Location Longitude:-77.4729
Webserver Software:openresty

Is "Cogent Communications" in the Top 10 Hosting Companies?

Name
Percentage
DoD Network Information Center
16.7387%
GoDaddy.com, LLC
8.5968%
Namecheap, Inc.
4.2653%
Confluence Networks Inc
2.7791%
Google Inc.
2.3954%
Merit Network Inc.
1.8799%
Fara Negar Pardaz Khuzestan
1.8361%
1&1 Internet AG
1.8274%
Amazon.com, Inc.
1.7814%
Cogent Communications
1.6096%

HTTP Header Analysis for Kajabi.co

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: openresty
Date: Thu, 08 Apr 2021 01:29:42 GMT
Content-Type: text/html
Content-Length: 24288
Connection: keep-alive
Content-Encoding: gzip
content-security-policy: frame-ancestors 'self'
x-frame-options: SAMEORIGIN
Via: 1.1 varnish, 1.1 varnish
Accept-Ranges: bytes
Age: 347
X-Served-By: cache-dca12920-DCA, cache-dub4330-DUB
X-Cache: HIT, HIT
X-Cache-Hits: 2, 1
X-Timer: S1617845382.236387,VS0,VE1
Vary: Accept-Encoding
X-Cluster-Name: eu-west-1-prod-eks-15

Kajabi.co Domain Nameserver Information

HostIP AddressCountry
ns1.dnsimple.com 162.159.24.4
ns2.dnsimple.com 162.159.25.4
ns3.dnsimple.com 162.159.26.4
ns4.dnsimple.com 162.159.27.4


Need to find out who hosts Kajabi.co?


Domain Registration (WhoIs) information for Kajabi.co

 Number of allowed queries exceeded. 

Websites with Similar Names

Kajaba.com
Hier entsteht eine neue Homepage
Kajabardon.com
Kaja Bardon -
Kajabee.com
Join the Fun - Free Digital Business and Online Sales Platform
Kajabi.agency
kajabi.agency | Registrado en DonDominio
Kajabi.business
kajabi.business | Registrado en DonDominio
Kajabi.co
Create & Sell Online Courses & Coaching With Kajabi
Kajabi.com
Kajabi — The All-In-One Online Business Platform

Recently Updated Websites

Breeding-ground.com (1 second ago.)Kawaigin.com (1 second ago.)Globalexclusives.org (2 seconds ago.)Taxeroo.site (3 seconds ago.)Attractionstube.com (3 seconds ago.)Csdunes.org (3 seconds ago.)Eronudist.com (3 seconds ago.)Eaglestrikefitness.com (4 seconds ago.)Definecomputer.com (4 seconds ago.)Euro-comm.co.uk (4 seconds ago.)Georgiajurybill.com (4 seconds ago.)Bochas.com (4 seconds ago.)Realherostees.com (4 seconds ago.)Dandelionpartysupplies.com (4 seconds ago.)Tuningjournal.ru (4 seconds ago.)Quanmm.net (5 seconds ago.)Samedus.org (5 seconds ago.)Commonmanbrewing.com (5 seconds ago.)Facesofthenamib.com (5 seconds ago.)Vascoteous.space (6 seconds ago.)Aspiresda.org (6 seconds ago.)Bkutrk.com (6 seconds ago.)Doodlemation.com (6 seconds ago.)God-alife.com (6 seconds ago.)Yajing1035.com (6 seconds ago.)Prostomarkets.com (6 seconds ago.)Dreamhomestorage.com (6 seconds ago.)Familylifedaycare.com (6 seconds ago.)Airportparkinggiant.com (6 seconds ago.)Mrs-gili.com (7 seconds ago.)

Recently Searched Keywords

595 (2 seconds ago.)fatgirlphd (4 seconds ago.)vc ter (7 seconds ago.)plotters (8 seconds ago.)utraconego poczenia upewnij (9 seconds ago.)eitlerimikro keratin kaynak (10 seconds ago.)energy fighting (11 seconds ago.)cartucce (11 seconds ago.)建設業 (14 seconds ago.)tcbtoastmessage (15 seconds ago.)divdata-hookwix-vod-widget-direction-containerdirltr (18 seconds ago.)dust bin bag white (for kitchen) oxo bio degradable (ecas certified) 100 pcs bundle (25 seconds ago.)turkish (34 seconds ago.)april 17 2020 (42 seconds ago.)visa agents in gurgaon (47 seconds ago.)disinhibition dysgraphia processing (54 seconds ago.)swiper-button-prevhoverafter (57 seconds ago.)185 190 (1 minute 2 seconds ago.)alex larsson (1 minute 3 seconds ago.)img_0084.jpg (1 minute 6 seconds ago.)img_0076.jpg (1 minute 7 seconds ago.)first one (1 minute 8 seconds ago.)rentals quality rentals to fit your needs the right place to start and a great way to access quality band instruments our rental program: quality rentalsaffordable and availablethe right fit for your needs (1 minute 9 seconds ago.)hache gn (1 minute 18 seconds ago.)general industry (1 minute 19 seconds ago.)rentals quality rentals to fit your needs the right place to start and a great way to access quality band instruments our rental program: quality rentalsaffordable and availablethe right fit for your needs (1 minute 19 seconds ago.)engineering and technology (1 minute 20 seconds ago.)metal beds (1 minute 21 seconds ago.)aj bell youinvest (1 minute 24 seconds ago.)top 100 (1 minute 33 seconds ago.)