KAMAGRAEREKTION - ONLINESHOP für Potenzmittel & mehr

Safety: Low trust score
Year Founded: 2021
Global Traffic Rank: Unknown
Estimated Worth: $9
Category: This site has not been categorized yet

Kamagraerektion Onlineshop für Potenzmittel und mehr. Auf der bekannte Onlineshop Kamagraerektion finden Sie die größte Auswahl an Potenzmitteln



Domain summary

Last updated
2021-12-07
Domain label
kamagraerektion
Domain extension
eu
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Frequently Asked Questions (FAQ)

Q: When was Kamagraerektion.eu registered?
A: Kamagraerektion.eu was registered 1 month, 2 weeks, 6 days, 20 hours, 3 minutes, 50 seconds ago on Tuesday, December 7, 2021.
Q: When was the WHOIS for Kamagraerektion.eu last updated?
A: The WHOIS entry was last updated 1 month, 2 weeks, 6 days, 20 hours, 3 minutes, 50 seconds ago on Tuesday, December 7, 2021.
Q: What are Kamagraerektion.eu's nameservers?
A: DNS for Kamagraerektion.eu is provided by the following nameservers:
  • dns2016b.trouble-free.net
  • dns2016a.trouble-free.net
Q: Who is the registrar for the Kamagraerektion.eu domain?
A: The domain has been registered at EURID.
Q: What is the traffic rank for Kamagraerektion.eu?
A: Kamagraerektion.eu has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Kamagraerektion.eu each day?
A: Kamagraerektion.eu receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Kamagraerektion.eu resolve to?
A: Kamagraerektion.eu resolves to the IPv4 address 64.20.45.195.
Q: In what country are Kamagraerektion.eu servers located in?
A: Kamagraerektion.eu has servers located in the United States.
Q: What webserver software does Kamagraerektion.eu use?
A: Kamagraerektion.eu is powered by LiteSpeed webserver.
Q: Who hosts Kamagraerektion.eu?
A: Kamagraerektion.eu is hosted by IS-AS-1 in United States.
Q: How much is Kamagraerektion.eu worth?
A: Kamagraerektion.eu has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Kamagraerektion.eu Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Kamagraerektion.eu Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Kamagraerektion.eu

H1 Headings

0 :

H2 Headings

2 :
  1. Cart
  2. ONLINESHOP für Potenzmittel & mehr

H3 Headings

5 :
  1. Top Angebot: Kamagra® 100 mg 100 Tabletten nur € 99,-
  2. Kontaktiere Uns
  3. Mein Konto
  4. Kamagra Erektion
  5. Produkt Kategorien

H4 Headings

3 :
  1. Arbeitszeit
  2. Kostenloser Versand
  3. Geld-Zurück-Garantie

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

4 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

55:

Links - Internal (nofollow)

0:

Links - Outbound

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Kamagraerektion.eu

eli 20kamagra 100mg kamagrapotenzmitteloral jellyincludemalegra0oral100 mg kamagrarevolutionsoftvalif100 mgeli120 mgkamagra oral jellyextra superhtmldivcssjelly kamagra oral3eli 20 mgunssildenafilpforcetadarise200 mghardon20 mg tadalafilmgjellysildenafil tadalafilmg malegrahtmldivinnerhtmlerrormessageckamagraavanafilvardapoxetin12super pforce20 mgextrasupersliderkamagra oraljelly kamagraoral jelly kamagratadalafilvardenafilmg tadalafilkamagra 100 mg

Who hosts Kamagraerektion.eu?

Kamagraerektion.eu Hosting Provider Information

Hosted IP Address:64.20.45.195
Hosted Hostname:mobiigroups.com
Service Provider:IS-AS-1
Hosted Country:United StatesUS
Location Latitude:37.751
Location Longitude:-97.822
Webserver Software:LiteSpeed

Is "IS-AS-1" in the Top 10 Hosting Companies?

Name
Percentage
Unknown
19.8811%
GOOGLE
13.4918%
AS-26496-GO-DADDY-COM-LLC
3.5494%
NAMECHEAP-NET
3.0231%
AMAZON-AES
2.1497%
GoDaddy.com, LLC
2.0016%
UNIFIEDLAYER-AS-1
1.8740%
Fara Negar Pardaz Khuzestan
1.5314%
CONFLUENCE-NETWORK-INC
1.4027%
1&1 Internet AG
1.2887%
IS-AS-1
0.0322%

HTTP Header Analysis for Kamagraerektion.eu

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Connection: Keep-Alive
Keep-Alive: timeout=5, max=100
content-type: text/html; charset=UTF-8
link:; rel=shortlink
content-length: 16344
content-encoding: gzip
vary: Accept-Encoding
date: Tue, 07 Dec 2021 06:46:32 GMT
server: LiteSpeed
strict-transport-security: max-age=31536000
alt-svc: h3=":443"; ma=2592000, h3-29=":443"; ma=2592000, h3-Q050=":443"; ma=2592000, h3-Q046=":443"; ma=2592000, h3-Q043=":443"; ma=2592000, quic=":443"; ma=2592000; v="43,46"

Kamagraerektion.eu Domain Nameserver Information

HostIP AddressCountry
dns2016b.trouble-free.net 64.20.42.243
dns2016a.trouble-free.net 64.20.42.242


Need to find out who hosts Kamagraerektion.eu?


Domain Registration (WhoIs) information for Kamagraerektion.eu

 % The WHOIS service offered by EURid and the access to the records
% in the EURid WHOIS database are provided for information purposes
% only. It allows persons to check whether a specific domain name
% is still available or not and to obtain information related to
% the registration records of existing domain names.
%
% EURid cannot, under any circumstances, be held liable in case the
% stored information would prove to be wrong, incomplete or not
% accurate in any sense.
%
% By submitting a query you agree not to use the information made
% available to:
%
% - allow, enable or otherwise support the transmission of unsolicited,
% commercial advertising or other solicitations whether via email or
% otherwise;
% - target advertising in any possible way;
%
% - to cause nuisance in any possible way to the registrants by sending
% (whether by automated, electronic processes capable of enabling
% high volumes or other possible means) messages to them.
%
% Without prejudice to the above, it is explicitly forbidden to extract,
% copy and/or use or re-utilise in any form and by any means
% (electronically or not) the whole or a quantitatively or qualitatively
% substantial part of the contents of the WHOIS database without prior
% and explicit permission by EURid, nor in any attempt hereof, to apply
% automated, electronic processes to EURid (or its systems).
%
% You agree that any reproduction and/or transmission of data for
% commercial purposes will always be considered as the extraction of a
% substantial part of the content of the WHOIS database.
%
% By submitting the query you agree to abide by this policy and accept
% that EURid can take measures to limit the use of its WHOIS services
% in order to protect the privacy of its registrants or the integrity
% of the database.
%
% The EURid WHOIS service on port 43 (textual whois) never
% discloses any information concerning the registrant.
% Registrant and on-site contact information can be obtained through use of the
% webbased WHOIS service available from the EURid website www.eurid.eu
%
% WHOIS kamagraerektion.eu
Domain: kamagraerektion.eu
Script: LATIN

Registrant:
NOT DISCLOSED!
Visit www.eurid.eu for webbased WHOIS.

On-site(s):
NOT DISCLOSED!
Visit www.eurid.eu for webbased WHOIS.

Technical:
Organisation: Mirosit
Language: en
Email: Login to show email
Webconnect8 Group
Website: https://webconnect8.eu

Name servers:
ns2.kamagraerektion.eu (70.39.150.2)
ns1.kamagraerektion.eu (74.124.210.242)

Please visit www.eurid.eu for more info.

Websites with Similar Names

Kamagaci.com
kamagaci.com | Isimtescil.net | Ücretsiz yap?m a?amas?nda sayfas?
Kamagafuchishaho.xyz
Apache HTTP Server Test Page powered by CentOS
Kamagaia.com
Welcome kamagaia.com - BlueHost.com
Kamagains.net
Kamagains - Kamas Giveaways
Kamagames.com
KamaGames is the largest European social mobile poker operator.

Recently Updated Websites

Pandemie-corona.com (2 seconds ago.)Clairlimo.com (2 seconds ago.)Rynlv.clothing (3 seconds ago.)Yibobet4106.com (3 seconds ago.)Namo.com (3 seconds ago.)Historyside.com (7 seconds ago.)Best-matters.com (7 seconds ago.)Foundermoney.com (8 seconds ago.)Shtballs.com (9 seconds ago.)Theckfirm.com (9 seconds ago.)Lux-antiques.com (9 seconds ago.)Greasegirlgarage.com (10 seconds ago.)Bio-naturel.de (12 seconds ago.)Wine-logic.com (13 seconds ago.)Calliope2-game.com (13 seconds ago.)415tohel.com (14 seconds ago.)News1x1.com (14 seconds ago.)Devenbourquin.com (17 seconds ago.)Theultimate.gift (17 seconds ago.)Masterapp.in (20 seconds ago.)Sucrezsalez.com (21 seconds ago.)Lansingrecreationalweed.com (22 seconds ago.)Cpridahofalls.com (22 seconds ago.)Aasintec.com (24 seconds ago.)466700.com (24 seconds ago.)Mfyou.org (27 seconds ago.)Leyuvip682.com (29 seconds ago.)Deutscher-hilfsmittelvertrieb.de (30 seconds ago.)Lesbouchons.sg (32 seconds ago.)Projectmanagers.net (33 seconds ago.)

Recently Searched Keywords

本科招生信息 (1 second ago.)help fight fraud (2 seconds ago.)samsung galaxy s20 fe 5g (2 seconds ago.)linking (2 seconds ago.)african american books (3 seconds ago.)ytu65 (4 seconds ago.)essayratio100optiondissertationratio150optiondissertation abstractratio100optiondissertation chapterratio100optiondissertation (4 seconds ago.)rodel-alexander-arts-and-crafts (4 seconds ago.)ivibe app (4 seconds ago.)lady gaga songs ranked (5 seconds ago.)smartconnect (5 seconds ago.)void aerrorjqueryarcticmodal (5 seconds ago.)nackenstützkissen (5 seconds ago.)b cng (6 seconds ago.)ダッドスニーカー fila 人気 (6 seconds ago.)1311px (7 seconds ago.)proven ai for all data and processes (7 seconds ago.)bếp điện từ bosch pmi968ms (7 seconds ago.)nsaids side effects dogs (7 seconds ago.)龙吴 (8 seconds ago.)hotline vpbank hải ph (8 seconds ago.)autocad 2017 free download (8 seconds ago.)coordinate geometry (9 seconds ago.)文章(百度百科简介) (10 seconds ago.)search all used land rover vehicles (10 seconds ago.)từ 10 (12 seconds ago.)rygbuh64 (15 seconds ago.)autoplaytrue autoplaytimeout5000 smartspeed750 (15 seconds ago.)cenanbsp (16 seconds ago.)theatro municipal (16 seconds ago.)