KARAKALEM PORTRE ÇİZDİRME SİTESİ | KARAKALEM RESİM

Safety: Low trust score
Year Founded: 2011
Global Traffic Rank: Unknown
Estimated Worth: $9
Last updated:2020-10-25
Category: This site has not been categorized yet


Domain summary

Domain label
karakalemresim
Domain extension
net
Domain registered:
2011-06-03
Domain updated:
2020-03-07
Domain expires:
2021-06-03
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is karakalemresim.net ranked relative to other sites:

Percentage of visits to karakalemresim.net from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Karakalemresim.net registered?
A: Karakalemresim.net was registered 9 years, 7 months, 2 weeks, 2 days, 20 hours, 37 minutes, 15 seconds ago on Friday, June 3, 2011.
Q: When was the WHOIS for Karakalemresim.net last updated?
A: The WHOIS entry was last updated 10 months, 1 week, 5 days, 20 hours, 37 minutes, 15 seconds ago on Saturday, March 7, 2020.
Q: What are Karakalemresim.net's nameservers?
A: DNS for Karakalemresim.net is provided by the following nameservers:
  • ns53.dnscini.com
Q: Who is the registrar for the Karakalemresim.net domain?
A: The domain has been registered at PDR LTD. D/B/A PUBLICDOMAINREGISTRY.COM.
Q: What is the traffic rank for Karakalemresim.net?
A: Karakalemresim.net has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Karakalemresim.net each day?
A: Karakalemresim.net receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Karakalemresim.net resolve to?
A: Karakalemresim.net resolves to the IPv4 address 93.187.203.203.
Q: In what country are Karakalemresim.net servers located in?
A: Karakalemresim.net has servers located in the Turkey.
Q: What webserver software does Karakalemresim.net use?
A: Karakalemresim.net is powered by LiteSpeed webserver.
Q: Who hosts Karakalemresim.net?
A: Karakalemresim.net is hosted by Netdirekt A.S. in Turkey.
Q: How much is Karakalemresim.net worth?
A: Karakalemresim.net has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Karakalemresim.net Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Karakalemresim.net Free SEO Report

Website Inpage Analysis for Karakalemresim.net

H1 Headings

5 :
  1. KARAKALEM PORTRE ÇİZDİRME SİTESİ
  2.  
  3. MEHMET EMİN DOĞAN KARAKALEM PORTRE ÇİZERKEN
  4. Bu sitenin bütün içeriği Mehmet Emin DOĞAN'a aittir, izinsiz kopyalanamaz.
  5.  

H2 Headings

3 :
  1. KARAKALEM ÇİZİMLERİMİZ
  2. SIKÇA SORULAN SORULAR
  3. ATATÜRK VE SANAT

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

2 :

Total Images

11 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

33:

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Karakalemresim.net

vekikarakalem portremilleticcedilindenbspmizimleribirportrefotorafacilnaslnbsp nbsp nbspiseyapmazresimbir millet kikarakalemnbsp nbspbir milletvardeilmillet kiccedilok

Who hosts Karakalemresim.net?

Karakalemresim.net Hosting Provider Information

Hosted IP Address:93.187.203.203
Hosted Hostname:ns53-out.dnscini.com
Service Provider:Netdirekt A.S.
Hosted Country:TurkeyTR
Location Latitude:41.0214
Location Longitude:28.9948
Webserver Software:LiteSpeed

Is "Netdirekt A.S." in the Top 10 Hosting Companies?

Name
Percentage
GoDaddy.com, LLC
9.5100%
DoD Network Information Center
8.4509%
Google Inc.
2.8338%
Confluence Networks Inc
2.6217%
Amazon.com, Inc.
2.1737%
Namecheap, Inc.
2.1384%
TOT Public Company Limited
1.5665%
1&1 Internet AG
1.5512%
Merit Network Inc.
1.3856%
Unified Layer
1.3043%
Netdirekt A.S.
0.0186%

HTTP Header Analysis for Karakalemresim.net

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Connection: Keep-Alive
Expires: Sun, 19 Nov 1978 05:00:00 GMT
Last-Modified: Sun, 25 Oct 2020 04:09:49 GMT
Cache-Control: post-check=0, pre-check=0
Content-Type: text/html; charset=utf-8
Transfer-Encoding: chunked
Content-Encoding: br
Vary: Accept-Encoding,User-Agent
Date: Sun, 25 Oct 2020 04:09:49 GMT
Server: LiteSpeed

Karakalemresim.net Domain Nameserver Information

HostIP AddressCountry
ns53.dnscini.com 195.244.42.2Turkey Turkey


Need to find out who hosts Karakalemresim.net?


Domain Registration (WhoIs) information for Karakalemresim.net

 Domain Name: KARAKALEMRESIM.NET
Registry Domain ID: 1643969272_DOMAIN_NET-VRSN
Registrar WHOIS Server: whois.publicdomainregistry.com
Registrar URL: www.publicdomainregistry.com
Updated Date: 2020-03-07T16:27:50Z
Creation Date: 2011-03-06T18:38:13Z
Registrar Registration Expiration Date: 2021-03-06T18:38:13Z
Registrar: PDR Ltd. d/b/a PublicDomainRegistry.com
Registrar IANA ID: 303
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registry Registrant ID: Not Available From Registry
Registrant Name: MEHMET EMIN DOGAN
Registrant Organization: None
Registrant Street: KARAKOPRU SEN EVLER BEHRAM SITE NO 18
Registrant City: SANLIURFA
Registrant State/Province: MERKEZ
Registrant Postal Code: 63100
Registrant Country: TR
Registrant Phone: +90.905056701188
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: Login to show email
Admin ID: Not Available From Registry
Admin Name: MEHMET EMIN DOGAN
Admin Organization: None
Admin Street: KARAKOPRU SEN EVLER BEHRAM SITE NO 18
Admin City: SANLIURFA
Admin State/Province: MERKEZ
Admin Postal Code: 63100
Admin Country: TR
Admin Phone: +90.905056701188
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: Login to show email
Tech ID: Not Available From Registry
Tech Name: MEHMET EMIN DOGAN
Tech Organization: None
Tech Street: KARAKOPRU SEN EVLER BEHRAM SITE NO 18
Tech City: SANLIURFA
Tech State/Province: MERKEZ
Tech Postal Code: 63100
Tech Country: TR
Tech Phone: +90.905056701188
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: Login to show email
Server: ns1.hostcini.com
Name Server: ns53.dnscini.com
DNSSEC: Unsigned
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.2013775952
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2020-10-25T04:09:50Z

Websites with Similar Names

Karak-house.com
coming soon
Karak.click
karak.click -&nbspkarak Resources and Information.
Karak.ir
کارک :: خرید و فروش سرویس های آنلاین
Karak.xyz
Kiborgnet
Karaka.co
Karaka Osijek | +385 (0)31 203 500
Karaka.com
This Domain Name is registered at Epik.com
Karaka.io
Sorry we are not yet ready
Karakacreamery.site
Build a Free Website - Website Builder

Recently Updated Websites

Nepaljankari.com (56 seconds ago.)Monchestoma.ru (2 minutes 50 seconds ago.)Ilovephysics.org (6 minutes 42 seconds ago.)Ayak-isiticisi.com (6 minutes 46 seconds ago.)Buyorget.com (7 minutes 5 seconds ago.)Hearsay.info (7 minutes 6 seconds ago.)Nursingschedules.com (7 minutes 11 seconds ago.)Scale.repair (7 minutes 11 seconds ago.)Jmarvel.com (7 minutes 11 seconds ago.)Filateliatalavera.com (7 minutes 11 seconds ago.)Andshift.org (7 minutes 11 seconds ago.)Covid193d.be (7 minutes 12 seconds ago.)Ssjp.info (7 minutes 12 seconds ago.)Ukulele.ph (7 minutes 12 seconds ago.)Mxuno.com (7 minutes 12 seconds ago.)Pill.tv (7 minutes 12 seconds ago.)Myanimesoline.com (7 minutes 12 seconds ago.)Covid19statistik.de (7 minutes 12 seconds ago.)Judoinbebra.de (7 minutes 12 seconds ago.)Hamzawy.org (7 minutes 12 seconds ago.)Tubidy.top (7 minutes 12 seconds ago.)Clairescabinetrefinishing.com (7 minutes 12 seconds ago.)Gymaholic.net (7 minutes 12 seconds ago.)Celulap.com (7 minutes 13 seconds ago.)Westcoastfitnesscentre.com (7 minutes 13 seconds ago.)Potcourier.com (7 minutes 13 seconds ago.)Move2you.com (7 minutes 13 seconds ago.)Dingdong.info (7 minutes 13 seconds ago.)Followappweb.com (7 minutes 13 seconds ago.)Fscmi.com (7 minutes 13 seconds ago.)

Recently Searched Keywords

915 213 (2 seconds ago.)قیمت ورق ام دی اف خام 8 میل (2 seconds ago.)parteitag (3 seconds ago.)rum shot (3 seconds ago.)dual-core cpu (4 seconds ago.)home ship (6 seconds ago.)روغن خراطین (9 seconds ago.)logotipo (9 seconds ago.)ipsw (10 seconds ago.)resourcestrainingmeetupsmy cakephpcakefestnewsletterlinkedinyoutubefacebooktwitter (13 seconds ago.)clicking here (15 seconds ago.)capacitación y formación (16 seconds ago.)educacion (16 seconds ago.)decisionbuddyapp (17 seconds ago.)ve eitim (18 seconds ago.)jbj95 (18 seconds ago.)style-k3uqjxfr2navcontainercenter-direction (19 seconds ago.)16:03 شعر أحمر ، عسل إسباني ، تحب اسبيرانزا ديل هورنو أن تحصل على مارس الجنس في الملابس الداخلية ، حتى أنها cums (19 seconds ago.)x062ax0648x0645x0627x064629 add (19 seconds ago.)jak dobrać olej silnikowy castrol (20 seconds ago.)etykiety kruszące (21 seconds ago.)moscow boys choir (22 seconds ago.)winston salem (22 seconds ago.)vieussan (26 seconds ago.)rekonstrukce (30 seconds ago.)班主任工作 (30 seconds ago.)dysmenorrhea (32 seconds ago.)consolelogattaching (33 seconds ago.)film x francais amateur (33 seconds ago.)consolelogrequest (35 seconds ago.)