KatHO: Katholische Hochschule Nordrhein-Westfalen

Safety: Low trust score
Year Founded: 2020
Global Traffic Rank: 194,522
Estimated Worth: $8,640

Die Katholische Hochschule NRW bietet die Fachgebiete Sozialwesen, Gesundheitswesen und Theologie an den Standorten Köln, Münster, Aachen und Paderborn.

katho-nrw, katholische hochschule, nordrhein westfalen, nrw, studium, katholische hochschule nrw, katholische hochschule nordrhein westfalen, katho, katho nrw, kathonrw, kato, bildung, hochschulausbildung, professorinnen, professoren, forscher, forscherinnen, forschung, forschungsschwerpunkt, forschen, ausbilden, ausbilder, ausbildung, weiterbildung, weiterbilden, international, europäisch, grundrechte, verfassung, verfassungsprinzip, verfassungsstaat, rechtsstaat, sozial, soziales, sozialer, sozialem, soziale, sozialdienste, sozialsystem, sozialstaat, sozialstaatsprinzip, sozialpolitik, sozialrecht, sozialmanagement, ausgleich, projekt, diskriminierung, nachteile, sozialverträglich, sozialarbeiterinnen, sozialarbeiter, sozialarbeit, sozialpädagogik, pädagogik, pädagogen, pädagoginnen, professor, wissenschaft, wissenschaftlerinnen, wissenschaftler, sa, sp, hp, heilpädagogik, heilen, helfen, heilende, helfende, supervision, gesundheit, gesundheitssystem, gesundheitsdienste, drg, krank, pflege, pfleger, pflegerinnen, pflegen, pflegewissenschaft, pflegewissenschaften, pflegende, pflegeheime, pflegemanagement, pflegemanger, pflegemangerinnen, pflegepädagogik, pflegepädagogen, pflegepädagoginnen, pflegerecht, krankenhaus, krankenhäuser, hospital, hospitalmanagement, gesundheitsmanagement, gesundheitsmanager, gesundheitsmangerinnen, krankenhausmanagement, krankenhausmanager, krankenhausmanagerinnen, fachschule, fachschüler, fachschülerinnen, arztrecht, arzthaftungsrecht, arzt, ärztin, ärztinnen, ärzte, facharzt, fachärztin, fachärztinnen, fachärzte, sucht, süchtige, suchtforschung, suchttherapie, suchthilfe, therapie, multiprofessionell, alleinerziehende, gleichstellung, alterung, generation, generationen, jva, justiz, recht, politik, psychologie, medizin, betriebswirtschaft, kulturpädagogik, medienpädagogik, kooperationsmanagement, behinderung, behinderte, streetwork, streetworker, management, manager, managerinnen, altenhilfe, altenheime, altenpflege, religion, konfession, religionspädagogik, gemeindereferent, gemeindereferentin, kirchliche, bildungsarbeit, gemeinde, pfarrgemeinde, pfarrbezirk, pfarrei, bibel, moraltheologie, pastoraltheologie, ethik, pastoral, kirche, kirchen, hochschule, fh, bistum, bistümer, erzbistum, erzbistümer, ersatzschulgesetz, generalvikar, bischof, wissen, weisheit, theorie, konzepte, praxis, theoretisch, praktisch, praxistransfer, forschungstransfer, theorie praxis transfer, lehre, lehren, lehrende, lehrbeauftragte, stellenangebote, stellengesuche, akademisch, akademie, institut, an institut, in institut, campus, euregio, studieren, studierende, student, studentin, studenten, studentinnen, studienplatzbewerbung, einschreibung, immatrikulation, exmatrikulation, matrikel, studienbuch, rückmeldung, semesterferien, studienplatz, studienberatung, studieninformation, studien, vorlesung, seminar, prüfung, prüfungsamt, kolloquium, zvs, kompaktstudium, frauenstudium, aufbaustudium, weiterbildungsstudium, weiterbildungsstudiengang, studienverwaltung, karriereberatung, studienverlauf, studentenparlament, studierendenvertretung, studentenvertretung, studententheater, asta, stupa, semester, semestergebühren, wintersemester, sommersemester, studienjahr, studiengebühren, studienkosten, studienkonten, rektor, rektorin, kanzlerin, kanzler, prorektor, prorektorin, verwaltungsdirektor, verwaltungsrat, gesellschafter, gesellschafterversammlung, kfh, katholische, fachhochschule, private, staatlich, anerkannt, kirchlich, fachbereich, fachbereiche, studiengang, studiengänge, school, university, applied, science, college, acadedmy, degree, postgradual, sozialwesen, gesundheitswesen, theologie, aachen, köln, münster, paderborn, essen, fachhochschulen, hochschulsystem, pius, schuman, leo, wörth, rudolf, schwarz, hülchrather, rektorat, zentralverwaltung, hochschulverwaltung, selbstverwaltung, hochschulgremien, senat, hochschulabschluss, diplom, master, bachelor, ma, ba, m.sc., m.a., rkf, hrk, che, daad, eu, europäische, union, grenzüberschreitend, bibliothek, hochschulbibliothek, fh bibliothek, bibliotheken, virtuelle, katho bibliothek, meissner, mussinghoff, lettmann, beckers, caritas, caritasverband, katholisch, weltjugendtag, katholikentag, ökumene, ökumenisch, lvr, landschaftverband, palästina, skopje, bethlehem, rom, barcelona, madrid, zürich, sittard, nl, niederlande, belgien, frontiera, front, euroset, auslandsbeauftragte, auslandsberatung, auslandsaufenthalt, auslandsbeauftragter, auslandsstudium, auslandsreise, auslandskoordination, auslandskontakt, auslandssemester, auslandspraxiskinder, kinder, erzieher, erzieherin, bildung und erziehung im kindesalter  Show all keywords


Domain summary

Last updated
2020-10-17
Domain label
katho-nrw
Domain extension
de
Global Traffic Rank
194,522
Statvoo Rating
F
Trust Score
Low Trust Score
Estimated worth
$8,640
Estimated daily income
$24
Estimated monthly income
$730

Frequently Asked Questions (FAQ)

Q: When was Katho-nrw.de registered?
A: Katho-nrw.de was registered 1 year, 3 months, 1 week, 23 hours, 49 minutes, 41 seconds ago on Saturday, October 17, 2020.
Q: When was the WHOIS for Katho-nrw.de last updated?
A: The WHOIS entry was last updated 5 years, 8 months, 3 weeks, 6 days, 23 hours, 49 minutes, 41 seconds ago on Wednesday, April 27, 2016.
Q: What are Katho-nrw.de's nameservers?
A: DNS for Katho-nrw.de is provided by the following nameservers:
  • ns1.domaindiscount24.net
  • ns2.domaindiscount24.net
  • ns3.domaindiscount24.net
Q: Who is the registrar for the Katho-nrw.de domain?
A: The domain has been registered at DENIC eG.
Q: What is the traffic rank for Katho-nrw.de?
A: Katho-nrw.de ranks 194,522 globally on Alexa. Katho-nrw.de has a Low Trust Score, and a Statvoo Rank of F.
Q: How many people visit Katho-nrw.de each day?
A: Katho-nrw.de receives approximately 2,685 visitors and 8,055 page impressions per day.
Q: What IP address does Katho-nrw.de resolve to?
A: Katho-nrw.de resolves to the IPv4 address 195.202.49.154.
Q: In what country are Katho-nrw.de servers located in?
A: Katho-nrw.de has servers located in the Germany.
Q: What webserver software does Katho-nrw.de use?
A: Katho-nrw.de is powered by Apache/2.4.7 (Ubuntu) webserver.
Q: Who hosts Katho-nrw.de?
A: Katho-nrw.de is hosted by 1&1 Versatel Deutschland GmbH in Free And Hanseatic City Of Hamburg, Hamburg, Germany, 20355.
Q: How much is Katho-nrw.de worth?
A: Katho-nrw.de has an estimated worth of $8,640. An average daily income of approximately $24, which is roughly $730 per month.

Katho-nrw.de Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Katho-nrw.de Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Katho-nrw.de

H1 Headings

0 :

H2 Headings

3 :
  1. Aktuelle NachrichtenRSS Feed   
  2. Weltoffene Hochschulen – Gegen Fremdenfeindlichkeit
  3. Informationen zur Studienplatzbewerbung

H3 Headings

7 :
  1. 15.10.2020 KatHO NRW
  2. 14.10.2020 KatHO NRW
  3. 12.10.2020 KatHO NRW
  4. 09.10.2020 KatHO NRW
  5. 06.10.2020 KatHO NRW
  6. 05.10.2020 KatHO NRW
  7. Intranet-Login

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

11 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

255:

Links - Internal (nofollow)

0:

Keyword Cloud for Katho-nrw.de

kln abtbei notfllen krisenevaluationgleichstellung familiesiekln alumniveranstaltung kathoverbindethochschuleinklusionfr sthetikfrfaktenleitungfortbildungenzentrumkatho nrwimzuhochschule nordrheinwestfalenvolnotfllen krisensozialwesenfachbereichlehrefachbereichkathoverbindet volsthetikentwicklungforschungsprofilforschungsstrategieforschungs und entwicklungsschwerpunkteinstitutegegender kathonrwnrwforschungsfrderung und transferthirdbarrierefreiheitaufcoberatungsabt klnanfahrtstudiumnrwforschungsfrderungbei notfllenmasterstudiengngeseminarekln alumniveranstaltungfr pflegelehrerinnenbildungpflegelehrerinnenbildunghochschuleverwaltungtrgergesellschafthochschulentwicklung evaluationgleichstellungjahre kathoder katho nrwforschungsfrderungfamilie in dercookiesabtentwicklungforschungsprofilforschungsstrategieforschungsinformationenverwaltungtrgergesellschafthochschulentwicklungzumkathoverbindetbeider hochschuleinklusiondiekathoeinschreibung coberatungs0faktenleitung verwaltungtrgergesellschafthochschulentwicklung evaluationgleichstellungalumniveranstaltunggegen fremdenfeindlichkeitkatho nrwforschungsfrderungderfremdenfeindlichkeitalumniveranstaltung kathoverbindetnotfllenvonnordrheinwestfalenber dieabt kln alumniveranstaltungder hochschulehochschulitpresseberdenfortbildungenzentrum framkln abt klnhochschulenjahreevaluationgleichstellungalumniveranstaltung kathoverbindet volkrisenentwicklungsschwerpunkteinstitutefamiliemittransferkontaktthirdfaktenleitung verwaltungtrgergesellschafthochschulentwicklunghochschulehochschulitpresseeinschreibungentwicklungsschwerpunkteinstitute an dersichmissionweiterbildungpostgradualevon cookiesklnmehrtransferthirdverwaltungtrgergesellschafthochschulentwicklung evaluationgleichstellung familie

Longtail Keyword Density for Katho-nrw.de

KeywordsOccurences
familie in der10
bei notfllen krisen6
faktenleitung verwaltungtrgergesellschafthochschulentwicklung evaluationgleichstellung6
verwaltungtrgergesellschafthochschulentwicklung evaluationgleichstellung familie6
kln abt kln6
entwicklungforschungsprofilforschungsstrategieforschungs- und entwicklungsschwerpunkteinstitute4
entwicklungsschwerpunkteinstitute an der4
der katho nrwforschungsfrderung4
nrwforschungsfrderung und transferthird4
abt kln alumni-veranstaltung3
kln alumni-veranstaltung kathoverbindet3
alumni-veranstaltung kathoverbindet vol3
evaluationgleichstellung familie8
abt kln7
katho nrw7
der katho7
faktenleitung verwaltungtrgergesellschafthochschulentwicklung6
kln abt6
bei notfllen6
notfllen krisen6
verwaltungtrgergesellschafthochschulentwicklung evaluationgleichstellung6
jahre katho4
der hochschulehochschul-itpresse-4
katho nrwforschungsfrderung4
fortbildungenzentrum fr4
kathoverbindet vol4
einschreibung coberatungs-4
der hochschuleinklusion4
fr sthetik4
fr pflegelehrerinnenbildung4
ber die3
gegen fremdenfeindlichkeit3
hochschule nordrhein-westfalen3
alumni-veranstaltung kathoverbindet3
kln alumni-veranstaltung3
von cookies3
der40
fr26
katho23
kln14
die11
familie10
einschreibung10
am9
abt9
anfahrtstudium8
entwicklungforschungsprofilforschungsstrategieforschungs-8
zu8
evaluationgleichstellung8
bei7
nrw7
entwicklungsschwerpunkteinstitute6
krisen6
faktenleitung6
verwaltungtrgergesellschafthochschulentwicklung6
notfllen6
sie6
sozialwesenfachbereich6
mit5
kathoverbindet4
vol4
auf4
04
den4
cookies4
zum4
missionweiterbildungpostgraduale4
hochschule4
lehrefachbereich4
coberatungs-4
jahre4
transferkontaktthird4
pflegelehrerinnenbildung4
hochschulehochschul-itpresse-4
hochschuleinklusion4
sthetik4
nrwforschungsfrderung4
transferthird4
masterstudiengngeseminare4
fortbildungenzentrum4
barrierefreiheit3
alumni-veranstaltung3
im3
hochschulen3
gegen3
fremdenfeindlichkeit3
sich3
informationen3
mehr3
ber3
nordrhein-westfalen3
von3

Who hosts Katho-nrw.de?

Katho-nrw.de Hosting Provider Information

Hosted IP Address:195.202.49.154
Hosted Hostname:195.202.49.154
Service Provider:1&1 Versatel Deutschland GmbH
Hosted Country:GermanyDE
Location Latitude:53.5574
Location Longitude:9.9812
Webserver Software:Apache/2.4.7 (Ubuntu)

Is "1&1 Versatel Deutschland GmbH" in the Top 10 Hosting Companies?

Name
Percentage
Unknown
19.8811%
GOOGLE
13.4918%
AS-26496-GO-DADDY-COM-LLC
3.5494%
NAMECHEAP-NET
3.0231%
AMAZON-AES
2.1497%
GoDaddy.com, LLC
2.0016%
UNIFIEDLAYER-AS-1
1.8740%
Fara Negar Pardaz Khuzestan
1.5314%
CONFLUENCE-NETWORK-INC
1.4027%
1&1 Internet AG
1.2887%
1&1 Versatel Deutschland GmbH
0.0012%

HTTP Header Analysis for Katho-nrw.de

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Sat, 17 Oct 2020 23:43:52 GMT
Server: Apache/2.4.7 (Ubuntu)
X-Powered-By: PHP/5.5.9-1ubuntu4.29
Content-Length: 16920
Content-Encoding: gzip
Vary: Accept-Encoding
Content-Type: text/html; charset=utf-8

Katho-nrw.de Domain Nameserver Information

HostIP AddressCountry
ns1.domaindiscount24.net 94.23.153.36
ns2.domaindiscount24.net 66.206.3.125
ns3.domaindiscount24.net 144.217.35.18


Need to find out who hosts Katho-nrw.de?


Domain Registration (WhoIs) information for Katho-nrw.de

 % Restricted rights.
%
% Terms and Conditions of Use
%
% The above data may only be used within the scope of technical or
% administrative necessities of Internet operation or to remedy legal
% problems.
% The use for other purposes, in particular for advertising, is not permitted.
%
% The DENIC whois service on port 43 doesn't disclose any information concerning
% the domain holder, general request and abuse contact.
% This information can be obtained through use of our web-based whois service
% available at the DENIC website:
% http://www.denic.de/en/domains/whois-service/web-whois.html
%
%

Domain: katho-nrw.de
Nserver: ns1.domaindiscount24.net
Nserver: ns2.domaindiscount24.net
Nserver: ns3.domaindiscount24.net
Status: connect
Changed: 2016-04-27T08:52:37+02:00

Websites with Similar Names

Katho-nrw.de
KatHO: Katholische Hochschule Nordrhein-Westfalen
Katho-shop.com
Cajón flamenco Katho Percusión ENVIO GRATIS Fabricación española
Katho.be
Not Found
Katho.nrw
katho – Katholische Hochschule Nordrhein-Westfalen
Katho.site
FanCentro - your ultimate portal to the hottest private Stories, Clips, and Content Feeds of tens of thousands influencers

Recently Updated Websites

Itppackaging.com (17 minutes 50 seconds ago.)Pipos.demitrans.ru (1 hour 6 minutes ago.)Ims-na1.adobelogin.com (1 hour 19 minutes ago.)Qckinetix.com (1 hour 44 minutes ago.)Vavada-cas.fun (1 hour 59 minutes ago.)Trackscourier.com (2 hours 35 minutes ago.)Instabagus.cc (2 hours 37 minutes ago.)Hotforex.diskusiforex.com (2 hours 38 minutes ago.)Tradinguang.com (2 hours 39 minutes ago.)Fbs.diskusiforex.com (2 hours 40 minutes ago.)Dasarforex.net (2 hours 43 minutes ago.)Marcinorzolek.pl (2 hours 45 minutes ago.)Tvmusicnetwork.net (3 hours 6 minutes ago.)Mb4.boobi.biz (3 hours 25 minutes ago.)Mb3.boobi.biz (3 hours 25 minutes ago.)Mb2.boobi.biz (3 hours 25 minutes ago.)Mb1.boobi.biz (3 hours 26 minutes ago.)Az.bitium.net (3 hours 37 minutes ago.)Ko.bitium.net (3 hours 40 minutes ago.)Ro.bitium.net (3 hours 40 minutes ago.)Pl.bitium.net (3 hours 41 minutes ago.)Ar.bitium.net (3 hours 42 minutes ago.)Sl.bitium.net (3 hours 43 minutes ago.)Haw.bitium.net (3 hours 44 minutes ago.)Bitium.net (3 hours 46 minutes ago.)Usounoul.com (4 hours 16 minutes ago.)Nykyd.chmpr.ru (4 hours 25 minutes ago.)Mejoresjuegosparaandroid.com (4 hours 31 minutes ago.)Poweritworld.com (4 hours 53 minutes ago.)Helpingdigital.com (4 hours 54 minutes ago.)

Recently Searched Keywords

一月一法清单 (1 second ago.)lapas medaeng sidoarjo (1 second ago.)codecademy python 3 (1 second ago.)original design (4 seconds ago.)project plans (4 seconds ago.)blog-shortcodeblog-list-shortcode-id-f665fb25ce2a3e8d78eeed74df458f37notmode-masonry (5 seconds ago.)divui-searchbar-body margin-right (6 seconds ago.)marucci (7 seconds ago.)crã©ation (7 seconds ago.)lttd class8221namebank8221 style8221padding-left (8 seconds ago.)cảnh quan (9 seconds ago.)tinea versicolor treatment (10 seconds ago.)pingfang sc medium (11 seconds ago.)lagi new city bình thuận (12 seconds ago.)higinicos (13 seconds ago.)procrastinate (14 seconds ago.)request a consultation (15 seconds ago.)rodri3torres released 2018 (17 seconds ago.)мойка (18 seconds ago.)thysanura (19 seconds ago.)talento (20 seconds ago.)orders & fulfillment (20 seconds ago.)future stars (20 seconds ago.)u043fu0440u0438u0435u043c (20 seconds ago.)- photo retouching (21 seconds ago.)shroff (22 seconds ago.)local sales network crossville tn (24 seconds ago.)便利なショルダーバッグ (27 seconds ago.)1 h (28 seconds ago.)kaitao song (30 seconds ago.)