Kidszone.de Website Information

Kidszone.de has a Low Trust Score, a Statvoo Rank of I, an Alexa Rank of 1,467,299, a Majestic Rank of 0, a Domain Authority of 42% and is not listed in DMOZ.

Kidszone.de is hosted by QSC AG in Germany.
Kidszone.de has an IP Address of 62.146.104.132 and a hostname of 62.146.104.132.

The domain kidszone.de was registered 201 decades 8 years 9 months ago by , it was last modified 9 years 5 months 4 days ago and currently is set to expire 201 decades 8 years 9 months ago.


Whois information for kidszone.de

Full Whois Lookup for Kidszone.de Whois Lookup

% Copyright (c) 2010 by DENIC
% Version: 2.0
%
% Restricted rights.
%
% Terms and Conditions of Use
%
% The data in this record is provided by DENIC for informational purposes only.
% DENIC does not guarantee its accuracy and cannot, under any circumstances,
% be held liable in case the stored information would prove to be wrong,
% incomplete or not accurate in any sense.
%
% All the domain data that is visible in the whois service is protected by law.
% It is not permitted to use it for any purpose other than technical or
% administrative requirements associated with the operation of the Internet.
% It is explicitly forbidden to extract, copy and/or use or re-utilise in any
% form and by any means (electronically or not) the whole or a quantitatively
% or qualitatively substantial part of the contents of the whois database
% without prior and explicit written permission by DENIC.
% It is prohibited, in particular, to use it for transmission of unsolicited
% and/or commercial and/or advertising by phone, fax, e-mail or for any similar
% purposes.
%
% By maintaining the connection you assure that you have a legitimate interest
% in the data and that you will only use it for the stated purposes. You are
% aware that DENIC maintains the right to initiate legal proceedings against
% you in the event of any breach of this assurance and to bar you from using
% its whois service.
%
% The DENIC whois service on port 43 never discloses any information concerning
% the domain holder/administrative contact. Information concerning the domain
% holder/administrative contact can be obtained through use of our web-based
% whois service available at the DENIC website:
% http://www.denic.de/en/domains/whois-service/web-whois.html
%

Domain: kidszone.de
Nserver: ns1.computec.de
Nserver: ns2.ip-exchange.de
Status: connect
Changed: 2015-04-17T08:44:52+02:00

[Tech-C]
Type: PERSON
Name: IP Exchange Hostmaster
Organisation: IP Exchange GmbH
Address: Am Tower 5
PostalCode: 90475
City: Nuernberg
CountryCode: DE
Phone: +49 911 30950000
Fax: +49 911 30950089
Email: Login to show email
2010-02-11T09:09:05+01:00

[Zone-C]
Type: PERSON
Name: IP Exchange Hostmaster
Organisation: IP Exchange GmbH
Address: Am Tower 5
PostalCode: 90475
City: Nuernberg
CountryCode: DE
Phone: +49 911 30950000
Fax: +49 911 30950089
Email: Login to show email
2010-02-11T09:09:05+01:00

Who hosts Kidszone.de?

Kidszone.de Web Server Information

Hosted IP Address:62.146.104.132
Hosted Hostname:62.146.104.132
Service Provider:QSC AG
Hosted Country:GermanyDE
Location Latitude:51
Location Longitude:9
Webserver Software:Not Applicable

HTTP Header Analysis for Kidszone.de

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Sat, 30 May 2015 23:25:01 GMT
Server: Apache
Pragma: no-cache
Expires: {ts '2015-05-31 01:25:01'}
Content-Language: de-DE
X-Clacks-Overhead: GNU Terry Pratchett
Vary: Accept-Encoding
Content-Encoding: gzip
Transfer-Encoding: chunked
Content-Type: text/html; charset=UTF-8


Need to find out who hosts Kidszone.de?

Kidszone.de Free SEO Report

Website Inpage Analysis for Kidszone.de

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Kidszone.de

trevorquickpc x360editionen releasezeit preloadmansbluray dvd16sich4 septemberkaufberatungxbo 1ishide getcookiehide1willits18jetzt ber denmodderinrabbidsbeim ausbruch abgestrztspanischerkingdom battle im1445 uhrfinalim behindgeheimer missiongames24mario rabbids kingdomwir jetzt berabcontent rn trnps4zuraliceneuenrabbids kingdom battleesjahrenwindowskeindritten14content rntrailerimmerupdate 135starbattlepubgkingdom battleishide getcookiehide1 ps4woche neu imvideorntt contentbutton rngyptenabstecherpc ps4tastatur und mausuntersttzung1615 uhrgodgamingliebe gemacht reviewvideo04092017nbspnbspdermehrdenfrmods weiterhinonebeiescapists 2 imtest beim ausbruchhalfvalvideo zuspielefilmeegg0nintendo snesjetzt9allerdingsandr linkennbsp 04092017eineausbruch abgestrztchosenentwicklerkommendeneditionen releasezeitbattle im testtastatureinber dengemacht reviewvideokurzzeitig2 im testttrn ttrndritten teilpc xborn rn rnttkomplettlsung mitalice american mcgeekomplettlsungoffiziell kein klempnertest beimsnesskylinesdieseps4 pcneuallemagicalartikelresident evilnintendotestmarioradeonhat dieschmiedenuhrvar2 editionen releasezeitamerican mcgeeupdate 412 imschmieden plnestormhathandelusdollarbestenullseptember bisoriginsseptember 2017im test mit3 sexsynchrovon andrbattlegrounds8rn rn contentxcomdeutsche telekomgameps4 pc xbowitcher0 1615 uhrwaldwelt okaar21ishide getcookiehide1 themaskyrimpeter molyneux26borderlandstrn ttrnmysteryauchamericanderishide getcookiehide1 pc3 sexsynchro grafikfailspc ps4 xboliebedeaddestiny 2122248 uhrplneschlussoutcast second contactttrn ttrn rnaugust4f1 2017rn rntrn trn ttrngeforce gtx 10802getcookiehide1 pcfeierlicheslifediese wochekommendeifdas wissen wirtrevor ryantest hardwareab septembersollfantasy 14done quickauf ps4topxcom 2rn rn rnunboxingvideoalienhorrorkomdieverkauffr dieals startseitemurrayundefinedplaystationseptember 0rn rn trnmissionsnes minirn rntt contentbuttonreviewvideoxcom 2 warden gyptenabstecher23easterder wochecontentbutton rn rnwaldwelt okaar imvon dergood lifexbo 0usdollar frps4 xbowaldweltdutyfallout 4okaar imorigins dasweiterhinscenesgames doneborderlands 3blurayrn content rnklempner mehrweitere4 september bisnewwidthgamescomnewendebehinddas wissengetcookiehide1 thema 0witcher feierliches videodestinyneuesrnttmultiplayerbetawir jetztstrange beforewissen wirdvdnewsstartseiteasylumpreload faqcall225000 usdollarsean murrayassassinsswitchcitieserscheintausgabemario istinfosthemaguidern trn trnrn rnttgrafikfails und mehrauspachterdritten teil entwickelntechnikdasskickttrn rnentwickler schmieden plneangekndigttelekom04092017functionneu im handelcontentuhrnbspnbspempire at warmehr im behindtrngemachtnosmart in geheimertest mitnintendo snes miniverffentlichtlinkennbspstrangegetcookiehide1 ps4woche neumausuntersttzungentwickler schmiedenpetertrn trngetcookiehide1 themavar ishide getcookiehide1konsolenpc gamesdiese woche neutestssecond contactseaneditionen25trn rnduty ww2var ishideplayerunknowns battlegroundsklempnerevilwarsdvd diese wochefaq zumspielfeierliches videoassassins creedlawbreakersdie waldweltmit liebe gemacht0 1615zufaqreleasezeitnachnewcontentrightdemreleasezeit preload faqplayerunknownsishidemodsxboxrnwochewissen wir jetztgaming pcescapistsgeheimerbaldohnereleasebeim ausbruch7rabbids kingdomno mans skyfifa 18mans skytrn rn rnmagical mysteryim testbeforedeutscheskyrn trnandr linkennbsptesogetcookiehide1 ps4 pc13nurwelcomeeaster egguhr topmit afkmario rabbidskein klempner mehrteil entwickelnoffiziell keinalice americansodauhr gpugames done quickkick offvideo zumzumauf der3test mit lieberntt contentbuttonwaramseptemberps3ampsavefallout 4 modderincreedkein klempner10gpuuntermcgeetrailer zurradeon rxkingdom22sexsynchro grafikfailskick off revivalspanischer hndlerimnewcontentleftupdateassassins creed originsf1wars empiregestartethardwareoff revival15cities skylinesdie neuegetcookiehide1bisrn trn rnabercontactgeforce gtxaufdestiny 2 editionentrueworld of speedwirswitchversionberpreload faq zumder entwickleraktuellenevil 4startzeitpcspielereleasezeit preloadmitweiterhin imoutcastlinkennbsp 04092017liebe gemachtchosen imx360 ps3xbox oneafk17die waldwelt okaarim verkaufmcgee will drittenhndlerim test beimfinal fantasy 14entwickelnrxoffizielldivwidthgameplaytrailertrailer zumsind19winwidthescapists 2revivalttrnjetzt ber1ryanspecialsim handel1015 uhrno mansgoodxbowindows 10vergleichfifacreed originsresident evil 4doneihr225000 usdollar frlife is strangern content6minielsecall of dutyresidentempirevorgeforceichjubilumthema 0before the storm1415 uhrmorrowindoffalswissenneu imgetcookiehide1 pc ps4scenes videoeditionokaarneuepreloadstar warsworldoutcast secondeinentrn ttrn ttrnkolumnenbattle imerstenfinal fantasy20star wars empiresave bugsim septemberorigins das wissenfalloutsexsynchrodiebluray dvd diesetippsclever smartmodderin kurzzeitigausbruchwitcher 3 sexsynchrotypeoffantasyteso morrowindandrmittelerdeuhrnbspnbsp rn rnpcww2teilcontentbuttonhdvom11unboxingdvd diesesmartmit liebemolyneux2 warx360filmcontentbutton rn4 modderinvideosdasvon andr linkennbspgameplayvideobugsmehr imgtx 1080witcher 3creed origins dasbeimsecond5vonspeedmods weiterhin im10jhrigenweiterhin im verkaufwelcome to willitsber den gyptenabstecheristdesdie entwicklerbehind the scenesps4 0gtx4 modderin kurzzeitignswfeierliches video zumcleveruhrnbspnbsp rnkommtarbeiten2 editionengrafikfailsabgestrztwitcher feierliches

Longtail Keyword Density for Kidszone.de

KeywordsOccurences
var ishide getcookiehide-139
rn rn rn38
ishide getcookiehide-1 pc16
pc ps4 xbo11
rn rn trn8
call of duty8
rabbids kingdom battle8
mario rabbids kingdom8
getcookiehide-1 pc ps48
no mans sky7
kingdom battle im6
assassins creed origins6
nintendo snes mini5
ishide getcookiehide-1 thema5
im test mit5
battle im test5
mit liebe gemacht5
test mit liebe5
test beim ausbruch4
2 im test4
before the storm4
beim ausbruch abgestrzt4
escapists 2 im4
life is strange4
rn trn trn4
feierliches video zum4
witcher feierliches video4
welcome to willits4
im test beim4
die waldwelt okaar4
outcast second contact4
behind the scenes4
ishide getcookiehide-1 ps44
destiny 2 editionen4
xcom 2 war4
content rn trn4
trn rn rn4
rn trn rn4
contentbutton rn rn4
rntt contentbutton rn4
trn trn ttrn4
rn rn rntt4
rn rntt contentbutton4
origins das wissen4
creed origins das4
uhrnbspnbsp rn rn4
wissen wir jetzt4
das wissen wir4
star wars empire3
tastatur- und mausuntersttzung3
mods weiterhin im3
4 modderin kurzzeitig3
empire at war3
weiterhin im verkauf3
getcookiehide-1 thema 03
4 september bis3
ps4 pc xbo3
games done quick3
225000 us-dollar fr3
woche neu im3
jetzt ber den3
ber den gypten-abstecher3
geforce gtx 10803
0 1615 uhr3
wir jetzt ber3
fallout 4 modderin3
blu-ray dvd diese3
diese woche neu3
dvd diese woche3
world of speed3
neu im handel3
3 sexsynchro grafik-fails3
preload faq zum3
release-zeit preload faq3
entwickler schmieden plne3
von andr linkennbsp3
andr linkennbsp 040920173
editionen release-zeit preload3
2 editionen release-zeit3
ttrn ttrn rn3
trn ttrn ttrn3
liebe gemacht review-video3
rn rn content3
rn content rn3
offiziell kein klempner3
kein klempner mehr3
resident evil 43
waldwelt okaar im3
final fantasy 143
alice american mcgee3
mcgee will dritten3
kick off revival3
getcookiehide-1 ps4 pc3
smart in geheimer3
witcher 3 sexsynchro3
grafik-fails und mehr3
mehr im behind3
dritten teil entwickeln3
rn rn63
var ishide39
ishide getcookiehide-139
im test19
getcookiehide-1 pc16
pc ps415
rn trn12
ps4 xbo12
destiny 212
rabbids kingdom9
trn rn8
duty ww28
kingdom battle8
creed origins8
mario rabbids8
fallout 47
pc games7
mans sky7
no mans7
xbox one6
assassins creed6
xcom 26
battle im6
4 september6
fr die6
witcher 36
trailer zum5
gaming pc5
mit liebe5
liebe gemacht5
test mit5
playerunknowns battlegrounds5
escapists 25
nintendo snes5
snes mini5
resident evil5
teso morrowind5
getcookiehide-1 thema5
trailer zur4
sexsynchro grafik-fails4
september 04
dritten teil4
getcookiehide-1 ps44
american mcgee4
waldwelt okaar4
good life4
video zum4
witcher feierliches4
feierliches video4
im handel4
die waldwelt4
uhr top4
scenes video4
ps4 pc4
outcast second4
second contact4
als startseite4
pc xbo4
rntt contentbutton4
rn rntt4
trn ttrn4
trn trn4
contentbutton rn4
origins das4
wir jetzt4
wissen wir4
das wissen4
content rn4
final fantasy4
strange before4
ausbruch abgestrzt4
beim ausbruch4
test beim4
2 war4
uhr gpu4
fifa 184
2248 uhr4
cities skylines4
uhrnbspnbsp rn4
2 im4
im september4
der woche4
2 editionen4
september 20174
4 modderin3
save bugs3
update 1353
1015 uhr3
mods weiterhin3
wars empire3
test hardware3
modderin kurzzeitig3
im verkauf3
225000 us-dollar3
done quick3
games done3
us-dollar fr3
ps4 03
radeon rx3
der entwickler3
ab september3
star wars3
1445 uhr3
dvd diese3
diese woche3
weiterhin im3
blu-ray dvd3
geforce gtx3
0 16153
1615 uhr3
gtx 10803
magical mystery3
den gypten-abstecher3
september bis3
spanischer hndler3
1415 uhr3
neu im3
borderlands 33
ber den3
jetzt ber3
woche neu3
windows 103
im behind3
andr linkennbsp3
linkennbsp 040920173
von andr3
schmieden plne3
entwickler schmieden3
mario ist3
offiziell kein3
clever smart3
auf der3
klempner mehr3
kein klempner3
mit afk3
die neue3
komplettlsung mit3
ttrn ttrn3
f1 20173
chosen im3
gemacht review-video3
ttrn rn3
rn content3
faq zum3
preload faq3
release-zeit preload3
editionen release-zeit3
geheimer mission3
3 sexsynchro3
update 413
alice american3
fantasy 143
von der3
easter egg3
teil entwickeln3
thema 03
xbo 03
sean murray3
peter molyneux3
trevor ryan3
evil 43
x360 ps33
off revival3
kick off3
video zu3
mehr im3
xbo 13
okaar im3
pc x3603
hat die3
deutsche telekom3
die entwickler3
auf ps43
rn103
uhr95
var70
im66
061
die56
pc47
145
von43
der41
ishide39
getcookiehide-139
fr38
mit34
test32
227
327
ps427
zum23
zu22
september21
das20
trn20
418
518
den17
mehr16
hat16
xbo16
jetzt15
destiny14
des14
auf14
trailer13
games13
video12
mario12
war11
function11
entwickler11
update11
witcher11
ist11
ber11
nintendo11
if11
neue10
news10
kingdom9
69
thema9
creed9
rabbids9
nach9
als9
79
origins8
ww28
battle8
life8
alle8
call8
duty8
no8
ein8
fallout7
sky7
xcom7
040920177
filme7
zur7
tests7
87
one7
mans7
ttrn7
97
am7
star7
xbox7
neues7
woche7
preload6
mini6
soll6
106
top6
evil6
tipps6
auch6
assassins6
startseite6
so6
beim6
gaming6
hardware6
ich6
morrowind6
august5
sich5
es5
game5
bald5
feierliches5
snes5
115
ersten5
radeon5
kommt5
battlegrounds5
weiterhin5
geforce5
jahren5
offiziell5
alice5
playerunknowns5
da5
einen5
edition5
liebe5
gemacht5
diese5
teso5
fifa5
switch5
wir5
ohne5
ausgabe5
resident5
escapists5
neuen5
windows4
faq4
ihr4
strange4
halfval4
okaar4
eine4
124
nur4
outcast4
skylines4
second4
waldwelt4
contact4
playstation4
before4
alien-horror-komdie4
willits4
welcome4
mcgee4
good4
gameplay-trailer4
storm4
chosen4
american4
winwidth4
gestartet4
134
cities4
ps34
aber4
world4
dritten4
teil4
release4
x3604
sind4
skyrim4
newwidth4
rntt4
content4
vom4
fantasy4
unter4
ausbruch4
contentbutton4
handel4
bei4
aktuellen4
konsolen4
editionen4
amp4
wissen4
uhrnbspnbsp4
verffentlicht4
144
verkauf4
sexsynchro4
grafik-fails4
gpu4
final4
bis4
abgestrzt4
film4
kurzzeitig4
154
dem4
videos4
kein4
behind4
scenes4
jubilum4
tastatur-3
10-jhrigen3
switch-version3
divwidth3
save3
immer3
dass3
bugs3
04092017nbspnbspder3
mausuntersttzung3
artikel3
mystery3
mittelerde3
vergleich3
163
weitere3
mods3
magical3
borderlands3
pachter3
god3
173
arbeiten3
183
empire3
modderin3
193
true3
newende3
gypten-abstecher3
newcontentleft3
hndler3
newcontentright3
multiplayer-beta3
gtx3
rx3
neu3
kaufberatung3
dvd3
203
blu-ray3
spanischer3
kick3
typeof3
pubg3
afk3
else3
erscheint3
213
unboxing-video3
schluss3
schmieden3
clever3
smart3
geheimer3
klempner3
linkennbsp3
plne3
andr3
release-zeit3
infos3
223
guide3
komplettlsung3
f13
gamescom3
spiele3
review-video3
specials3
beste3
null3
undefined3
startzeit3
hd3
technik3
pc-spiele3
kolumnen3
mission3
off3
molyneux3
sean3
murray3
peter3
ryan3
speed3
trevor3
spiel3
done3
ab3
angekndigt3
nsw3
lawbreakers3
us-dollar3
quick3
233
entwickeln3
kommende3
vor3
deutsche3
telekom3
kommenden3
gameplay-video3
revival3
aus3
allerdings3
243
unboxing3
253
263
dead3
asylum3
easter3
egg3
wars3

What are the nameservers for kidszone.de?

Kidszone.de Domain Nameserver Information

HostIP AddressCountry
ns1.computec.de 212.123.108.10Germany Germany
ns2.ip-exchange.de 212.123.98.101Germany Germany

Kidszone.de Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Kidszone.de is a scam?