KimiB.Good - gute Nachrichten rund ums Thema Nachhaltigkeit

Safety: Low trust score
Year Founded: 2021
Global Traffic Rank: Unknown
Estimated Worth: $9
Category: This site has not been categorized yet

Kimibgood.ch is a subdomain of Ch

KimiB.Good ist der Kanal für gute Nachrichten rund ums Thema Nachhaltigkeit und bietet euch informative Fakten, aufgedeckte Mythen und spannende Interviews.



Domain summary

Last updated
2021-09-21
Domain label
kimibgood
Domain extension
ch
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Frequently Asked Questions (FAQ)

Q: When was Kimibgood.ch registered?
A: Kimibgood.ch was registered 1 month, 6 days, 9 hours, 9 minutes, 54 seconds ago on Tuesday, September 21, 2021.
Q: When was the WHOIS for Kimibgood.ch last updated?
A: The WHOIS entry was last updated 1 month, 6 days, 9 hours, 9 minutes, 54 seconds ago on Tuesday, September 21, 2021.
Q: What are Kimibgood.ch's nameservers?
A: DNS for Kimibgood.ch is provided by the following nameservers:
  • ns161.servertown.ch
  • ns162.servertown.ch
Q: Who is the registrar for the Kimibgood.ch domain?
A: The domain has been registered at SWITCH Domain Name Registration.
Q: What is the traffic rank for Kimibgood.ch?
A: Kimibgood.ch has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Kimibgood.ch each day?
A: Kimibgood.ch receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Kimibgood.ch resolve to?
A: Kimibgood.ch resolves to the IPv4 address .
Q: In what country are Kimibgood.ch servers located in?
A: Kimibgood.ch has servers located in the .
Q: What webserver software does Kimibgood.ch use?
A: Kimibgood.ch is powered by Nginx webserver.
Q: Who hosts Kimibgood.ch?
A: Kimibgood.ch is hosted by Unknown in .
Q: How much is Kimibgood.ch worth?
A: Kimibgood.ch has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Kimibgood.ch Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Kimibgood.ch Free SEO Report

Website Inpage Analysis for Kimibgood.ch

H1 Headings

2 :
  1. KimiB.Good
  2. Schön, dass du vorbei schaust!

H2 Headings

7 :
  1. Willkommen bei KimiB.Good
  2. Blog
  3. Über mich
  4. Kontakt
  5. Kontakt
  6. Mit freundlicher Unterstützung von
  7. Partner: Impact Hub Candidate Basel

H3 Headings

3 :
  1. Geschenke-Tausch: Soziale Gerechtigkeit und Umweltvorsorge kinderleicht
  2. Mobilisieren will gelernt sein
  3. Repair | Connect | Repeat – die ReparierBar in Basel

H4 Headings

0 :

H5 Headings

1 :
  1. Herzlich Willkommen bei KimiB.Good – dem Kanal mit den guten Nachrichten rund ums Thema Nachhaltigkeit.

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

4 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Kimibgood.ch

einkritikichesweiterlesenreparierbarsrc cfjshostauf1kimguteswonachhaltige entwicklungauchich michverffentlicht amrundidtrythema nachhaltigkeiteuchreparierbar in baseleuredas thema nachhaltigkeitappendelementvartextjavascriptappendelement elementtypeentwicklungumreadystateoverflowintervalumweltvorsorgenull appendelementnachhaltigkeitkimibgoodverffentlichtdemnachhaltigeamweissscript type textjavascripttype textjavascriptelementtype scriptcfjshostappendelement elementtype scriptnulldasbaselguten nachrichtengerechtigkeit und umweltvorsorgetypegerechtigkeitcaptainformservicedomainmichtextjavascript idelementtypegoodvonhellipmirimsozialeimmerdasswelttype textjavascript idoderscriptfrmitsozu0novemberam novemberthemaderverffentlicht am novemberwietunsrcgutenifvieldiesrc cfjshost captainformservicedomainelementtype script typebesserkontaktnull appendelement elementtypeseincfjshost captainformservicedomaindenohne2019novemberbeinachrichtenmangood newsbersoziale gerechtigkeitdas themaistnewsscript type

Longtail Keyword Density for Kimibgood.ch

KeywordsOccurences
elementtype script type4
appendelement elementtype script4
script type textjavascript4
type textjavascript id4
das thema nachhaltigkeit3
verffentlicht am november3
gerechtigkeit und umweltvorsorge3
reparierbar in basel3
null appendelement elementtype3
src cfjshost captainformservicedomain3
appendelement elementtype4
thema nachhaltigkeit4
ich mich4
textjavascript id4
type textjavascript4
script type4
elementtype script4
good news3
src cfjshost3
soziale gerechtigkeit3
null appendelement3
guten nachrichten3
am november3
verffentlicht am3
das thema3
nachhaltige entwicklung3
cfjshost captainformservicedomain3
die14
ich13
mit13
das10
zu9
var9
mich8
basel7
nachhaltigkeit6
der6
appendelement6
kimibgood6
auch6
ber5
um5
november5
fr5
immer5
bei5
thema5
05
cfjshost4
kritik4
am4
if4
wie4
14
textjavascript4
type4
mir4
script4
elementtype4
id4
welt4
euch4
guten4
nachhaltige4
man4
ein4
nachrichten4
ist4
den4
dem4
kontakt4
try3
news3
null3
rund3
readystateoverflowinterval3
dass3
kim3
reparierbar3
von3
src3
entwicklung3
ohne3
hellip3
weiterlesen3
2019november3
gutes3
tun3
oder3
good3
so3
viel3
eure3
verffentlicht3
weiss3
wo3
soziale3
gerechtigkeit3
umweltvorsorge3
sein3
besser3
im3
auf3
es3
captainformservicedomain3

Who hosts Kimibgood.ch?

Kimibgood.ch Hosting Provider Information

Hosted IP Address:Not Applicable
Hosted Hostname:Not Applicable
Service Provider:Unknown
Hosted Country:Not Applicable
Location Latitude:Not Applicable
Location Longitude:Not Applicable
Webserver Software:nginx

Is "Unknown" in the Top 10 Hosting Companies?

Name
Percentage
GOOGLE
15.4249%
Unknown
11.7059%
AS-26496-GO-DADDY-COM-LLC
4.1307%
NAMECHEAP-NET
3.3122%
AMAZON-AES
2.5118%
GoDaddy.com, LLC
2.1535%
UNIFIEDLAYER-AS-1
2.1315%
Fara Negar Pardaz Khuzestan
1.7839%
CONFLUENCE-NETWORK-INC
1.5636%
1&1 Internet AG
1.4878%

HTTP Header Analysis for Kimibgood.ch

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx
Date: Tue, 21 Sep 2021 14:14:48 GMT
Content-Type: text/html; charset=UTF-8
Content-Length: 25608
Connection: keep-alive
X-Powered-By: PHP/7.1.33
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate
Pragma: no-cache
Link:; rel="https://api.w.org/", ; rel=shortlink
Vary: Accept-Encoding
Content-Encoding: gzip

Kimibgood.ch Domain Nameserver Information

HostIP AddressCountry
ns161.servertown.ch 94.231.94.136
ns162.servertown.ch 94.231.94.137


Need to find out who hosts Kimibgood.ch?


Domain Registration (WhoIs) information for Kimibgood.ch

Websites with Similar Names

Kimibeauty.co.uk
KimiBeauty Official Luxury Beauty & Fragrances - KimiBeauty
Kimibeauty.com
HugeDomains.com
Kimibeautylink.com
Kimi Beauty Link | Grosir Produk Kecantikan dan Kosmetik Terpercaya
Kimibestboy.com
mySPARK - your well-being app
Kimibfit.com
New User Gifts
Kimibgood.ch
KimiB.Good - gute Nachrichten rund ums Thema Nachhaltigkeit
Kimibike.com
kimibike.com is expired
Kimibikini.com
Kimkini - Dubai Beachwear and Swimwear

Recently Updated Websites

Xem-account.com (6 seconds ago.)Professionallystepping.com (9 seconds ago.)998999qp.com (9 seconds ago.)K-onekitchens.com (11 seconds ago.)Jawa-sa.com (11 seconds ago.)Industriepark-weinheim.de (12 seconds ago.)Yenitruvaotel.com (12 seconds ago.)Junglihome.com (12 seconds ago.)Bigskyhomesspokane.com (14 seconds ago.)Medicaidrecoveryaudits.com (15 seconds ago.)Alaynapotter.com (18 seconds ago.)Orionbotanica.com (18 seconds ago.)Mlarik.com (18 seconds ago.)Antikviteter.se (18 seconds ago.)Welbiltconnect.com (20 seconds ago.)Villasonrent.com (20 seconds ago.)Aqpitw.org (21 seconds ago.)Gcodegardens.com (22 seconds ago.)Ps3mediaserver.org (22 seconds ago.)Qu1qu.com (23 seconds ago.)Maptao.com (23 seconds ago.)Drinkkilimanjaro.com (25 seconds ago.)Plasserusa.us (25 seconds ago.)Chemglass.com (27 seconds ago.)Mantorshiftinitiative.com (28 seconds ago.)Noirenailbarvenicefl.com (28 seconds ago.)Aimartour.net (31 seconds ago.)Pacssafe.com (31 seconds ago.)Eds-perm.ru (31 seconds ago.)Gibbcleaning.com (31 seconds ago.)

Recently Searched Keywords

挑选规格 (1 second ago.)color52ffff (1 second ago.)webtrader (2 seconds ago.)who is it for (2 seconds ago.)firmware narzo 20a rmx2050 [flash file] free download (3 seconds ago.)ftp on the go pro (4 seconds ago.)startul (5 seconds ago.)our centers (5 seconds ago.)u0645u0646 u0641u0636u0644u0643 (5 seconds ago.)sitebanner (5 seconds ago.)с„рёр»сњрјс‹ (6 seconds ago.)sig rewards (7 seconds ago.)sheer (7 seconds ago.)jetbrains account (7 seconds ago.)eccertifiedcompany false (8 seconds ago.)view investors (8 seconds ago.)association of southeast (8 seconds ago.)medspa lkn (10 seconds ago.)bird bath accessories (11 seconds ago.)(pdt) (11 seconds ago.)khabib net worth (11 seconds ago.)diary books with locks (13 seconds ago.)customer area adyen (13 seconds ago.)中粳大厦陶粒应用案例 (14 seconds ago.)efectos adversos de la metformina para adelgazar (14 seconds ago.)huile essentielle pour dormir en pharmacie (14 seconds ago.)mp3 music (15 seconds ago.)form 990 ez (15 seconds ago.)tri-band (16 seconds ago.)dekton (17 seconds ago.)