Kitchencraft.co.uk

Website Thumbnail
Checking...
Kitchenware, Bakeware and Home Accessories | KitchenCraft

Safety: Low trust score
Year Founded: 11
Global Traffic Rank: 765,393
Estimated Worth: $1,680
Last updated:2020-10-29

As one of the UK’s largest kitchenware companies, Kitchen Craft takes pride in supplying a wide and exciting choice of over three thousand kitchen, dining and housewares items


Domain summary

Domain label
kitchencraft
Domain extension
co.uk
Domain registered:
11-Sep-1997
Domain updated:
11-Sep-2020
Domain expires:
2020-10-01
Global Traffic Rank
765,393
Statvoo Rating
H
Trust Score
Low Trust Score
Estimated worth
$1,680
Estimated daily income
$7
Estimated monthly income
$213

Rank summary

How is kitchencraft.co.uk ranked relative to other sites:

Percentage of visits to kitchencraft.co.uk from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Kitchencraft.co.uk registered?
A: Kitchencraft.co.uk was registered 23 years, 2 months, 3 weeks, 12 hours, 55 minutes, 42 seconds ago on Thursday, September 11, 1997.
Q: When was the WHOIS for Kitchencraft.co.uk last updated?
A: The WHOIS entry was last updated 2 months, 3 weeks, 12 hours, 55 minutes, 42 seconds ago on Friday, September 11, 2020.
Q: What are Kitchencraft.co.uk's nameservers?
A: DNS for Kitchencraft.co.uk is provided by the following nameservers:
  • ns1.livedns.co.uk
  • ns2.livedns.co.uk
  • ns3.livedns.co.uk
Q: Who is the registrar for the Kitchencraft.co.uk domain?
A: The domain has been registered at Nominet UK.
Q: What is the traffic rank for Kitchencraft.co.uk?
A: Kitchencraft.co.uk ranks 765,393 globally on Alexa. Kitchencraft.co.uk has a Low Trust Score, and a Statvoo Rank of H.
Q: How many people visit Kitchencraft.co.uk each day?
A: Kitchencraft.co.uk receives approximately 1,150 visitors and 2,300 page impressions per day.
Q: What IP address does Kitchencraft.co.uk resolve to?
A: Kitchencraft.co.uk resolves to the IPv4 address 176.34.129.129.
Q: In what country are Kitchencraft.co.uk servers located in?
A: Kitchencraft.co.uk has servers located in the Ireland.
Q: What webserver software does Kitchencraft.co.uk use?
A: Kitchencraft.co.uk is powered by Awselb/2.0 webserver.
Q: Who hosts Kitchencraft.co.uk?
A: Kitchencraft.co.uk is hosted by Amazon.com, Inc. in Leinster, Dublin, Ireland.
Q: How much is Kitchencraft.co.uk worth?
A: Kitchencraft.co.uk has an estimated worth of $1,680. An average daily income of approximately $7, which is roughly $213 per month.

Kitchencraft.co.uk Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Kitchencraft.co.uk Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Kitchencraft.co.uk

H1 Headings

3 :
  1. Ready, Steady, Bake
  2. No tricks, just treats!
  3. Christmas Baking

H2 Headings

31 :
  1. Baking
  2. Our Favourites
  3. Cooking
  4. Our Favourites
  5. Tools & Gadgets
  6. Our Favourites
  7. Dining
  8. Drinking
  9. Knives & Cutting
  10. Our Favourites
  11. Accessories
  12. Our Favourites
  13. Storage
  14. Sustainable Products
  15. Cleaning
  16. Our Favourites
  17. Gifts
  18. Our Favourites
  19. Easy to make Antioxidant Juice!
  20. Find a Stockist
  21. Account Login
  22. Don't have an account?
  23. Search over 6,000 products!
  24. Cook with confidence!
  25. Discover & Inspire
  26. Time to Bake!
  27. Halloween
  28. Bake for the big day!
  29. Brand Showcase
  30. KitchenCraft Story
  31. Find a Stockist

H3 Headings

8 :
  1. Brands
  2. Collections
  3. About KitchenCraft
  4. The Perfect Occasion!
  5. Find Inspiration
  6. From the Blog
  7. Watch our latest video
  8. Founded in 1850…  Every household in the UK has at least one of our products.

H4 Headings

7 :
  1. Follow Us On
  2. Useful Guides
  3. Account
  4. About Us
  5. Helpful Links
  6. Contact
  7. Join Our Newsletter

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

55 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

548:
  1. http://kitchencraft.co.uk/
    http://kitchencraft.co.uk/
  2. Kitchencraft Products
    http://kitchencraft.co.uk/categories
  3. Kitchencraft Baking
    http://kitchencraft.co.uk/categories/baking
  4. Kitchencraft Baking
    http://kitchencraft.co.uk/baking
  5. Kitchencraft View all
    http://kitchencraft.co.uk/baking
  6. Kitchencraft Bakeware
    http://kitchencraft.co.uk/categories/baking/bakeware-1
  7. Kitchencraft Crusty Bakeware
    http://kitchencraft.co.uk/categories/baking/bakeware-1/crusty-bakeware
  8. Kitchencraft Enamel Bakeware
    http://kitchencraft.co.uk/categories/baking/bakeware-1/enamel-bakeware
  9. Kitchencraft Silicone Flexible Bakeware
    http://kitchencraft.co.uk/categories/baking/bakeware-1/silicone-flexible-bakeware
  10. Kitchencraft Silver Anodised Bakeware
    http://kitchencraft.co.uk/categories/baking/bakeware-1/silver-anodised-bakeware
  11. Kitchencraft Baking Accessories
    http://kitchencraft.co.uk/categories/baking/baking-accessories
  12. Kitchencraft Pastry Brushes
    http://kitchencraft.co.uk/categories/baking/baking-accessories/pastry-brushes-1
  13. Kitchencraft Rolling Pins
    http://kitchencraft.co.uk/categories/baking/baking-accessories/rolling-pins-1
  14. Kitchencraft Sieves & Sifters
    http://kitchencraft.co.uk/categories/baking/baking-accessories/sieves-sifters-1
  15. Kitchencraft Bread Making & Loaf Tins
    http://kitchencraft.co.uk/categories/baking/breadmaking-loaftins
  16. Kitchencraft Cake Decorating
    http://kitchencraft.co.uk/categories/baking/cake-decorating
  17. Kitchencraft Cake Toppers & Candles
    http://kitchencraft.co.uk/categories/baking/cake-decorating/cake-toppers-candles
  18. Kitchencraft Fondant Cutters & Moulds
    http://kitchencraft.co.uk/categories/baking/cake-decorating/fondant-cutters-moulds
  19. Kitchencraft Icing Nozzles
    http://kitchencraft.co.uk/categories/baking/cake-decorating/icing-nozzles
  20. Kitchencraft Icing Sets & Kits
    http://kitchencraft.co.uk/categories/baking/cake-decorating/icing-sets-kits
  21. Kitchencraft Piping Bags
    http://kitchencraft.co.uk/categories/baking/cake-decorating/piping-bags
  22. Kitchencraft Cake Caddies & Tins
    http://kitchencraft.co.uk/categories/baking/cake-caddies-tins
  23. Kitchencraft Cake Pops
    http://kitchencraft.co.uk/categories/baking/cakepops
  24. Kitchencraft Cake Stands
    http://kitchencraft.co.uk/categories/baking/cakestands
  25. Kitchencraft Chocolate Making
    http://kitchencraft.co.uk/categories/baking/chocolate-making
  26. Kitchencraft Cooling Racks
    http://kitchencraft.co.uk/categories/baking/cooling-racks
  27. Kitchencraft Cookie & Pastry Cutters
    http://kitchencraft.co.uk/categories/baking/cookie-pastry-cutters
  28. Kitchencraft Cupcake & Muffin Cases
    http://kitchencraft.co.uk/categories/baking/cupcake-muffin-cases
  29. Kitchencraft Kids Baking
    http://kitchencraft.co.uk/categories/baking/kids-baking
  30. Kitchencraft Chocolate & Jelly Moulds
    http://kitchencraft.co.uk/categories/baking/kids-baking/chocolate-jelly-moulds
  31. Kitchencraft Cookie Cutters
    http://kitchencraft.co.uk/categories/baking/kids-baking/cookie-cutters
  32. Kitchencraft Timers & Thermometers
    http://kitchencraft.co.uk/categories/baking/kids-baking/timers-thermometers
  33. Kitchencraft Mixing Bowls
    http://kitchencraft.co.uk/categories/baking/mixingbowls
  34. Kitchencraft Oven Gloves, Tea Towels & Aprons
    http://kitchencraft.co.uk/categories/baking/oven-gloves-tea-towels-aprons
  35. Kitchencraft Aprons
    http://kitchencraft.co.uk/categories/baking/oven-gloves-tea-towels-aprons/aprons
  36. Kitchencraft Oven Gloves & Mitts
    http://kitchencraft.co.uk/categories/baking/oven-gloves-tea-towels-aprons/oven-gloves-mitts
  37. Kitchencraft Tea Towels
    http://kitchencraft.co.uk/categories/baking/oven-gloves-tea-towels-aprons/tea-towels-1
  38. Kitchencraft Pie Dishes
    http://kitchencraft.co.uk/categories/baking/pie-dishes
  39. Kitchencraft Presentation & Gifting
    http://kitchencraft.co.uk/categories/baking/presentation-gifting
  40. Kitchencraft Pudding Basins & Steamers
    http://kitchencraft.co.uk/categories/baking/pudding-basins-steamers
  41. Kitchencraft Weighing & Measuring
    http://kitchencraft.co.uk/categories/baking/weighing-measuring
  42. Kitchencraft Kitchen Scales
    http://kitchencraft.co.uk/categories/baking/weighing-measuring/kitchen-scales
  43. Kitchencraft Measuring Cups & Spoons
    http://kitchencraft.co.uk/categories/baking/weighing-measuring/measuring-cups-spoons
  44. Kitchencraft Measuring Jugs
    http://kitchencraft.co.uk/categories/baking/weighing-measuring/measuring-jugs
  45. Kitchencraft Thermometers & Timers
    http://kitchencraft.co.uk/categories/baking/weighing-measuring/thermometers-timers
  46. Kitchencraft La Cafetiere Barcelona Coffee Cup And Saucer
    http://kitchencraft.co.uk/brands/la_cafetiere/barcelona/la_cafetiere_barcelona_300ml_coffee_cup_and_saucer_plum.htm
  47. Kitchencraft MasterClass Cast Aluminium 26cm Fry Pan
    http://kitchencraft.co.uk/brands/masterclass/cast_aluminium_cookware/masterclass_cast_aluminium_26cm_fry_pan.htm
  48. Kitchencraft Colourworks "The Swip" Whisk and Bowl Scraper
    http://kitchencraft.co.uk/brands/colourworks/tools/colourworks_brights_red_the_swip_whisk_and_bowl_scraper.htm
  49. http://kitchencraft.co.uk/brands/built
    http://kitchencraft.co.uk/brands/built
  50. Kitchencraft Cooking
    http://kitchencraft.co.uk/categories/cooking
  51. Kitchencraft Cooking
    http://kitchencraft.co.uk/cooking
  52. Kitchencraft View all
    http://kitchencraft.co.uk/cooking
  53. Kitchencraft Casseroles
    http://kitchencraft.co.uk/categories/cooking/casseroles
  54. Kitchencraft Cast Iron
    http://kitchencraft.co.uk/categories/cooking/cast-iron
  55. Kitchencraft Ceramic Cookware
    http://kitchencraft.co.uk/categories/cooking/ceramic-cookware
  56. Kitchencraft Cookware Accessories
    http://kitchencraft.co.uk/categories/cooking/cookware-accessories
  57. Kitchencraft Fondues
    http://kitchencraft.co.uk/categories/cooking/fondues
  58. Kitchencraft Frypans & Griddles
    http://kitchencraft.co.uk/categories/cooking/frypans-griddles
  59. Kitchencraft Induction Ready Cookware
    http://kitchencraft.co.uk/categories/cooking/induction-ready-cookware
  60. Kitchencraft Microwave Cooking
    http://kitchencraft.co.uk/categories/cooking/microwave-cooking
  61. Kitchencraft Miniature Cookware
    http://kitchencraft.co.uk/categories/cooking/miniature-cookware
  62. Kitchencraft Oriental Cooking
    http://kitchencraft.co.uk/categories/cooking/oriental-cooking
  63. Kitchencraft Oven to Tableware
    http://kitchencraft.co.uk/categories/cooking/oven-to-tableware
  64. Kitchencraft Pots & Pans
    http://kitchencraft.co.uk/categories/cooking/pots-pans
  65. Kitchencraft Roasting
    http://kitchencraft.co.uk/categories/cooking/roasting
  66. Kitchencraft Steamers, Poachers & Smokers
    http://kitchencraft.co.uk/categories/cooking/steamers-poachers-smokers
  67. Kitchencraft Tools & Gadgets
    http://kitchencraft.co.uk/categories/tools-gadgets
  68. Kitchencraft Tools & Gadgets
    http://kitchencraft.co.uk/tools-gadgets
  69. Kitchencraft View all
    http://kitchencraft.co.uk/tools-gadgets
  70. Kitchencraft Basters
    http://kitchencraft.co.uk/categories/tools-gadgets/basters
  71. Kitchencraft Blowtorches & Lighters
    http://kitchencraft.co.uk/categories/tools-gadgets/blowtorches-lighers
  72. Kitchencraft Chippers & Ricers
    http://kitchencraft.co.uk/categories/tools-gadgets/chippers-ricers
  73. Kitchencraft Cutlery
    http://kitchencraft.co.uk/categories/tools-gadgets/cutlery-1
  74. Kitchencraft Egg Slicers, Separators & Accessories
    http://kitchencraft.co.uk/categories/tools-gadgets/egg-slicers-separators-accessories
  75. Kitchencraft Fruit & Vegetable Tools
    http://kitchencraft.co.uk/categories/tools-gadgets/fruit-vegetable-tools
  76. Kitchencraft Garlic Presses
    http://kitchencraft.co.uk/categories/tools-gadgets/garlic-presses
  77. Kitchencraft Ladles
    http://kitchencraft.co.uk/categories/tools-gadgets/ladles
  78. Kitchencraft Mashers
    http://kitchencraft.co.uk/categories/tools-gadgets/mashers
  79. Kitchencraft Meat & Fish Tools
    http://kitchencraft.co.uk/categories/tools-gadgets/meat-fish-tools
  80. Kitchencraft Openers
    http://kitchencraft.co.uk/categories/tools-gadgets/openers
  81. Kitchencraft Pasta Accessories
    http://kitchencraft.co.uk/categories/tools-gadgets/pasta-accessories
  82. Kitchencraft Peelers
    http://kitchencraft.co.uk/categories/tools-gadgets/peelers
  83. Kitchencraft Pizza Cutters
    http://kitchencraft.co.uk/categories/tools-gadgets/pizza-cutters
  84. Kitchencraft Salt & Pepper
    http://kitchencraft.co.uk/categories/tools-gadgets/salt-pepper
  85. Kitchencraft Scales & Measuring
    http://kitchencraft.co.uk/categories/tools-gadgets/scales-measuring
  86. Kitchencraft Scoops
    http://kitchencraft.co.uk/categories/tools-gadgets/scoops
  87. Kitchencraft Skewers & String
    http://kitchencraft.co.uk/categories/tools-gadgets/skewers
  88. Kitchencraft Spatulas
    http://kitchencraft.co.uk/categories/tools-gadgets/spatulas
  89. Kitchencraft Spoons
    http://kitchencraft.co.uk/categories/tools-gadgets/spoons
  90. Kitchencraft Tongs
    http://kitchencraft.co.uk/categories/tools-gadgets/tongs
  91. Kitchencraft Tool Collections
    http://kitchencraft.co.uk/categories/tools-gadgets/tool-collections
  92. Kitchencraft Heavy Duty Tools
    http://kitchencraft.co.uk/categories/tools-gadgets/tool-collections/heavy-duty-tools
  93. Kitchencraft Nylon Tools
    http://kitchencraft.co.uk/categories/tools-gadgets/tool-collections/nylon-tools
  94. Kitchencraft Serving Tools
    http://kitchencraft.co.uk/categories/tools-gadgets/tool-collections/serving-tools
  95. Kitchencraft Silicone Tools
    http://kitchencraft.co.uk/categories/tools-gadgets/tool-collections/silicone-tools-1
  96. Kitchencraft Soft Grip Tools
    http://kitchencraft.co.uk/categories/tools-gadgets/tool-collections/soft-grip-tools
  97. Kitchencraft Stainless Steel Tools
    http://kitchencraft.co.uk/categories/tools-gadgets/tool-collections/stainless-steel-tools
  98. Kitchencraft Wooden Tools
    http://kitchencraft.co.uk/categories/tools-gadgets/tool-collections/wooden-tools
  99. Kitchencraft Turners
    http://kitchencraft.co.uk/categories/tools-gadgets/turners
  100. Kitchencraft Whisks
    http://kitchencraft.co.uk/categories/tools-gadgets/whisks
  101. Kitchencraft Dining
    http://kitchencraft.co.uk/categories/dining
  102. Kitchencraft Dining
    http://kitchencraft.co.uk/dining
  103. Kitchencraft View all
    http://kitchencraft.co.uk/dining
  104. Kitchencraft Cutlery
    http://kitchencraft.co.uk/categories/dining/cutlery
  105. Kitchencraft Egg Cups
    http://kitchencraft.co.uk/categories/dining/egg-cups
  106. Kitchencraft Healthy Eating
    http://kitchencraft.co.uk/categories/dining/healthy-eating
  107. Kitchencraft Lunchboxes
    http://kitchencraft.co.uk/categories/dining/lunchboxes
  108. Kitchencraft Oil & Vinegar
    http://kitchencraft.co.uk/categories/dining/oil-vinegar
  109. Kitchencraft Placemats & Coasters
    http://kitchencraft.co.uk/categories/dining/placemats-coasters
  110. Kitchencraft Salt & Pepper
    http://kitchencraft.co.uk/categories/dining/salt-pepper
  111. Kitchencraft Seasonal Dining
    http://kitchencraft.co.uk/categories/dining/seasonal-dining
  112. Kitchencraft Serving
    http://kitchencraft.co.uk/categories/dining/serving
  113. Kitchencraft Tableware
    http://kitchencraft.co.uk/categories/dining/tableware
  114. Kitchencraft Trivets & Warmers
    http://kitchencraft.co.uk/categories/dining/trivets-warmers
  115. Kitchencraft Kids Dining
    http://kitchencraft.co.uk/categories/dining/kids-dining-1
  116. Kitchencraft Cutlery
    http://kitchencraft.co.uk/categories/dining/kids-dining-1/cutlery
  117. Kitchencraft Drinking
    http://kitchencraft.co.uk/categories/drinking
  118. Kitchencraft Drinking
    http://kitchencraft.co.uk/drinking
  119. Kitchencraft View all
    http://kitchencraft.co.uk/drinking
  120. Kitchencraft Bar Accessories
    http://kitchencraft.co.uk/categories/drinking/bar-accessories-1
  121. Kitchencraft Cafetieres & Coffee Makers
    http://kitchencraft.co.uk/categories/drinking/cafetieres-coffee-makers-1
  122. Kitchencraft Cocktails
    http://kitchencraft.co.uk/categories/drinking/drinking-cocktails
  123. Kitchencraft Flasks & Drinks Bottles
    http://kitchencraft.co.uk/categories/drinking/flasks-drinks-bottles-1
  124. Kitchencraft Glassware
    http://kitchencraft.co.uk/categories/drinking/drinking-glassware
  125. Kitchencraft Ice Moulds & Buckets
    http://kitchencraft.co.uk/categories/drinking/ice-moulds-buckets
  126. Kitchencraft Kettles
    http://kitchencraft.co.uk/categories/drinking/drinking-kettles
  127. Kitchencraft Mugs & Cups
    http://kitchencraft.co.uk/categories/drinking/mugs-cups
  128. Kitchencraft Parties
    http://kitchencraft.co.uk/categories/drinking/drinking-parties
  129. Kitchencraft Spirits
    http://kitchencraft.co.uk/categories/drinking/spirits
  130. Kitchencraft Tea & Coffee Accessories
    http://kitchencraft.co.uk/categories/drinking/tea-coffee-accessories
  131. Kitchencraft Teapots
    http://kitchencraft.co.uk/categories/drinking/drinking-teapots
  132. Kitchencraft Wine Accessories
    http://kitchencraft.co.uk/categories/drinking/wine-accessories
  133. Kitchencraft Knives & Cutting
    http://kitchencraft.co.uk/categories/knives-cutting
  134. Kitchencraft Knives & Cutting
    http://kitchencraft.co.uk/knives-cutting
  135. Kitchencraft View all
    http://kitchencraft.co.uk/knives-cutting
  136. Kitchencraft Cheese Serving & Carving
    http://kitchencraft.co.uk/categories/knives-cutting/cheese-serving
  137. Kitchencraft Chopping Boards
    http://kitchencraft.co.uk/categories/knives-cutting/chopping-boards
  138. Kitchencraft Graters & Mills
    http://kitchencraft.co.uk/categories/knives-cutting/grater-mills
  139. Kitchencraft Hachoirs & Cutters
    http://kitchencraft.co.uk/categories/knives-cutting/hachoirs
  140. Kitchencraft Individual Knives
    http://kitchencraft.co.uk/categories/knives-cutting/individual-knives
  141. Kitchencraft Knife Accessories
    http://kitchencraft.co.uk/categories/knives-cutting/knife-accessories
  142. Kitchencraft Knife Blocks & Sets
    http://kitchencraft.co.uk/categories/knives-cutting/knife-block-sets
  143. Kitchencraft Knife Collections
    http://kitchencraft.co.uk/categories/knives-cutting/knife-collections
  144. Kitchencraft Knife Sharpeners
    http://kitchencraft.co.uk/categories/knives-cutting/knife-sharpeners
  145. Kitchencraft Mandolines & Choppers
    http://kitchencraft.co.uk/categories/knives-cutting/mandolines-choppers
  146. Kitchencraft Scissors
    http://kitchencraft.co.uk/categories/knives-cutting/scissors
  147. Kitchencraft Worktop Protectors
    http://kitchencraft.co.uk/categories/knives-cutting/worktop-protectors
  148. Kitchencraft Woodware
    http://kitchencraft.co.uk/categories/knives-cutting/woodware
  149. Kitchencraft Accessories
    http://kitchencraft.co.uk/categories/accessories
  150. Kitchencraft Accessories
    http://kitchencraft.co.uk/accessories
  151. Kitchencraft View all
    http://kitchencraft.co.uk/accessories
  152. Kitchencraft Cast Iron Kitchen Accessories
    http://kitchencraft.co.uk/categories/accessories/cast-iron-kitchen-accessories
  153. Kitchencraft Cleaning
    http://kitchencraft.co.uk/categories/accessories/cleaning
  154. Kitchencraft Clips & Covers
    http://kitchencraft.co.uk/categories/accessories/clips-covers
  155. Kitchencraft Funnels
    http://kitchencraft.co.uk/categories/accessories/funnels
  156. Kitchencraft Kitchen Safety
    http://kitchencraft.co.uk/categories/accessories/kitchen-safety
  157. Kitchencraft Kitchen Storage
    http://kitchencraft.co.uk/categories/accessories/kitchen-storage
  158. Kitchencraft Bread Bins
    http://kitchencraft.co.uk/categories/accessories/kitchen-storage/bread-bins
  159. Kitchencraft Cake Tins
    http://kitchencraft.co.uk/categories/accessories/kitchen-storage/cake-tins
  160. Kitchencraft Cookbook Stands
    http://kitchencraft.co.uk/categories/accessories/kitchen-storage/cookbook-stands
  161. Kitchencraft Dish Drainers
    http://kitchencraft.co.uk/categories/accessories/kitchen-storage/dish-drainers
  162. Kitchencraft Mug Trees
    http://kitchencraft.co.uk/categories/accessories/kitchen-storage/mug-trees
  163. Kitchencraft Space Saving Solutions
    http://kitchencraft.co.uk/categories/accessories/kitchen-storage/space-saving-solutions
  164. Kitchencraft Spice Racks
    http://kitchencraft.co.uk/categories/accessories/kitchen-storage/spice-racks
  165. Kitchencraft Spoon Rests
    http://kitchencraft.co.uk/categories/accessories/kitchen-storage/spoon-rests
  166. Kitchencraft Storage Containers
    http://kitchencraft.co.uk/categories/accessories/kitchen-storage/storage-containers
  167. Kitchencraft Storage Jars
    http://kitchencraft.co.uk/categories/accessories/kitchen-storage/storage-jars
  168. Kitchencraft Towel Holders
    http://kitchencraft.co.uk/categories/accessories/kitchen-storage/towel-holders
  169. Kitchencraft Utensil Holders
    http://kitchencraft.co.uk/categories/accessories/kitchen-storage/utensil-holders
  170. Kitchencraft Kitchen Textiles
    http://kitchencraft.co.uk/categories/accessories/kitchen-textiles
  171. Kitchencraft Aprons
    http://kitchencraft.co.uk/categories/accessories/kitchen-textiles/accessories-aprons
  172. Kitchencraft Oven Gloves
    http://kitchencraft.co.uk/categories/accessories/kitchen-textiles/accessories-oven-gloves
  173. Kitchencraft Tea Towels
    http://kitchencraft.co.uk/categories/accessories/kitchen-textiles/accessories-tea-towels
  174. Kitchencraft Other
    http://kitchencraft.co.uk/categories/accessories/kitchen-textiles/accessories-other
  175. Kitchencraft Other Accessories
    http://kitchencraft.co.uk/categories/accessories/other-accessories
  176. Kitchencraft Outdoor Dining / Picnics
    http://kitchencraft.co.uk/categories/accessories/outdoor-dining-picnics
  177. Kitchencraft Recycling
    http://kitchencraft.co.uk/categories/accessories/recycling
  178. Kitchencraft Shopping
    http://kitchencraft.co.uk/categories/accessories/shopping
  179. Kitchencraft Sink Accessories
    http://kitchencraft.co.uk/categories/accessories/sink-accessories
  180. Kitchencraft Trays, Mats & Coasters
    http://kitchencraft.co.uk/categories/accessories/trays-mats-coasters
  181. Kitchencraft Trivets & Warmers
    http://kitchencraft.co.uk/categories/accessories/trivets-warmers
  182. Kitchencraft Wireware
    http://kitchencraft.co.uk/categories/accessories/wireware
  183. Kitchencraft Storage
    http://kitchencraft.co.uk/categories/storage
  184. Kitchencraft Storage
    http://kitchencraft.co.uk/storage
  185. Kitchencraft View all
    http://kitchencraft.co.uk/storage
  186. Kitchencraft Food Storage
    http://kitchencraft.co.uk/categories/storage/food-storage
  187. Kitchencraft Coolbags & Shopping Trolleys
    http://kitchencraft.co.uk/categories/storage/food-storage/coolbags-shopping-trolleys
  188. Kitchencraft Fridge Storage
    http://kitchencraft.co.uk/categories/storage/food-storage/fridge-storage
  189. Kitchencraft Fruit & Vegetable Storage
    http://kitchencraft.co.uk/categories/storage/food-storage/fruit-vegetable-storage
  190. Kitchencraft Lunchboxes
    http://kitchencraft.co.uk/categories/storage/food-storage/lunchboxes
  191. Kitchencraft Preserving Jars
    http://kitchencraft.co.uk/categories/storage/food-storage/preserving-jars
  192. Kitchencraft Storage Jars
    http://kitchencraft.co.uk/categories/storage/food-storage/storage-jars-1
  193. Kitchencraft Kitchen Storage
    http://kitchencraft.co.uk/categories/storage/kitchen-storage-1
  194. Kitchencraft Bread Bins
    http://kitchencraft.co.uk/categories/storage/kitchen-storage-1/bread-bins
  195. Kitchencraft Cake Tins
    http://kitchencraft.co.uk/categories/storage/kitchen-storage-1/cake-tins
  196. Kitchencraft Cookbook Stands
    http://kitchencraft.co.uk/categories/storage/kitchen-storage-1/cookbook-stands
  197. Kitchencraft Mug Trees
    http://kitchencraft.co.uk/categories/storage/kitchen-storage-1/mug-trees
  198. Kitchencraft Space Saving Solutions
    http://kitchencraft.co.uk/categories/storage/kitchen-storage-1/space-saving-solutions
  199. Kitchencraft Storage Containers
    http://kitchencraft.co.uk/categories/storage/kitchen-storage-1/storage-containers
  200. Kitchencraft Racks
    http://kitchencraft.co.uk/categories/storage/kitchen-storage-1/racks
  201. Kitchencraft Sustainable Products
    http://kitchencraft.co.uk/categories/sustainable-products
  202. Kitchencraft Sustainable Products
    http://kitchencraft.co.uk/sustainable-products
  203. Kitchencraft View all
    http://kitchencraft.co.uk/sustainable-products
  204. Kitchencraft Accessories
    http://kitchencraft.co.uk/categories/sustainable-products/sustainable-accessories
  205. Kitchencraft Cleaning
    http://kitchencraft.co.uk/categories/sustainable-products/sustainable-cleaning
  206. Kitchencraft Cooking
    http://kitchencraft.co.uk/categories/sustainable-products/sustainable-cooking
  207. Kitchencraft Dining
    http://kitchencraft.co.uk/categories/sustainable-products/sustainable-dining
  208. Kitchencraft Drinking
    http://kitchencraft.co.uk/categories/sustainable-products/sustainable-drinking
  209. Kitchencraft Bottles
    http://kitchencraft.co.uk/categories/sustainable-products/sustainable-drinking/sustainable-bottles
  210. Kitchencraft Accessories
    http://kitchencraft.co.uk/categories/sustainable-products/sustainable-drinking/sustainable-drinking-accessories
  211. Kitchencraft Travel Mugs
    http://kitchencraft.co.uk/categories/sustainable-products/sustainable-drinking/sustainable-travel-mugs
  212. Kitchencraft On-The-Go
    http://kitchencraft.co.uk/categories/sustainable-products/sustainable-on-the-go
  213. Kitchencraft Lunch Bags
    http://kitchencraft.co.uk/categories/sustainable-products/sustainable-on-the-go/sustainable-lunch-bags
  214. Kitchencraft Lunch Boxes
    http://kitchencraft.co.uk/categories/sustainable-products/sustainable-on-the-go/sustainable-lunch-boxes
  215. Kitchencraft Shopper Bags
    http://kitchencraft.co.uk/categories/sustainable-products/sustainable-on-the-go/sustainable-shopper-bags
  216. Kitchencraft Storage
    http://kitchencraft.co.uk/categories/sustainable-products/sustainable-storage
  217. Kitchencraft Cleaning
    http://kitchencraft.co.uk/categories/cleaning
  218. Kitchencraft Cleaning
    http://kitchencraft.co.uk/cleaning
  219. Kitchencraft View all
    http://kitchencraft.co.uk/cleaning
  220. Kitchencraft Bins
    http://kitchencraft.co.uk/categories/cleaning/bins
  221. Kitchencraft Housekeeping
    http://kitchencraft.co.uk/categories/cleaning/housekeeping
  222. Kitchencraft Sink
    http://kitchencraft.co.uk/categories/cleaning/sink
  223. Kitchencraft Brushes
    http://kitchencraft.co.uk/categories/cleaning/sink/brushes
  224. Kitchencraft Dish Drainers
    http://kitchencraft.co.uk/categories/cleaning/sink/dish-drainers
  225. Kitchencraft Sink Accessories
    http://kitchencraft.co.uk/categories/cleaning/sink/sink-accessories-1
  226. Kitchencraft Gifts
    http://kitchencraft.co.uk/categories/novelty-gifts
  227. Kitchencraft Gifts
    http://kitchencraft.co.uk/novelty-gifts
  228. Kitchencraft View all
    http://kitchencraft.co.uk/novelty-gifts
  229. Kitchencraft Gifts by Recipient
    http://kitchencraft.co.uk/categories/novelty-gifts/gifts-by-recipient
  230. Kitchencraft Gifts for Him
    http://kitchencraft.co.uk/categories/novelty-gifts/gifts-by-recipient/gifts-for-him
  231. Kitchencraft Gifts for Her
    http://kitchencraft.co.uk/categories/novelty-gifts/gifts-by-recipient/gifts-for-her
  232. Kitchencraft Gifts for Kids
    http://kitchencraft.co.uk/categories/novelty-gifts/gifts-by-recipient/gifts-for-kids
  233. Kitchencraft Gifts by Occasion
    http://kitchencraft.co.uk/categories/novelty-gifts/gifts-by-occasion
  234. Kitchencraft Anniversary
    http://kitchencraft.co.uk/categories/novelty-gifts/gifts-by-occasion/anniversary
  235. Kitchencraft Birthday
    http://kitchencraft.co.uk/categories/novelty-gifts/gifts-by-occasion/birthday
  236. Kitchencraft Engagement
    http://kitchencraft.co.uk/categories/novelty-gifts/gifts-by-occasion/engagement
  237. Kitchencraft New Home
    http://kitchencraft.co.uk/categories/novelty-gifts/gifts-by-occasion/new-home
  238. Kitchencraft Wedding
    http://kitchencraft.co.uk/categories/novelty-gifts/gifts-by-occasion/wedding
  239. Kitchencraft Gifts by Interest
    http://kitchencraft.co.uk/categories/novelty-gifts/gifts-by-interest
  240. Kitchencraft Aspiring Chef
    http://kitchencraft.co.uk/categories/novelty-gifts/gifts-by-interest/aspiring-chef
  241. Kitchencraft Coffee Lover
    http://kitchencraft.co.uk/categories/novelty-gifts/gifts-by-interest/coffee-lover
  242. Kitchencraft Gadget Lover
    http://kitchencraft.co.uk/categories/novelty-gifts/gifts-by-interest/gadget-lover
  243. Kitchencraft Gardener
    http://kitchencraft.co.uk/categories/novelty-gifts/gifts-by-interest/gardener
  244. Kitchencraft Gin Gifts
    http://kitchencraft.co.uk/categories/novelty-gifts/gifts-by-interest/gin-gifts
  245. Kitchencraft Pet Lover
    http://kitchencraft.co.uk/categories/novelty-gifts/gifts-by-interest/pet-lover
  246. Kitchencraft Gadgets & Novelty
    http://kitchencraft.co.uk/categories/novelty-gifts/gadgets-novelty
  247. Kitchencraft Brands & Collections
    http://kitchencraft.co.uk/brands
  248. Kitchencraft AnySharp
    http://kitchencraft.co.uk/brands/anysharp
  249. Kitchencraft AnySharp Pro Sharpener
    http://kitchencraft.co.uk/brands/anysharp/anysharp-pro-sharpener
  250. Kitchencraft AnySharp Essentials Sharpener
    http://kitchencraft.co.uk/brands/anysharp/anysharp-essentials-sharpener
  251. Kitchencraft AnySharp Scissors
    http://kitchencraft.co.uk/brands/anysharp/anysharp-scissors
  252. Kitchencraft Artesà
    http://kitchencraft.co.uk/brands/artesa
  253. Kitchencraft Cheese & Wine
    http://kitchencraft.co.uk/brands/artesa/cheese-and-wine
  254. Kitchencraft Cheese Boards, Platters & Knives
    http://kitchencraft.co.uk/brands/artesa/cheese-boards-platters-knives
  255. Kitchencraft Cook & Serve in Style
    http://kitchencraft.co.uk/brands/artesa/cook-serve-in-style
  256. Kitchencraft Dips, Sauces & Appetisers
    http://kitchencraft.co.uk/brands/artesa/dips-sauces-and-appetisers
  257. Kitchencraft Fondues & Raclettes
    http://kitchencraft.co.uk/brands/artesa/fondues-raclettes
  258. Kitchencraft Glass Serving
    http://kitchencraft.co.uk/brands/artesa/glass-serving
  259. Kitchencraft Make a Style Statement
    http://kitchencraft.co.uk/brands/artesa/make-a-style-statement
  260. Kitchencraft Marble Serving
    http://kitchencraft.co.uk/brands/artesa/marble-serving
  261. Kitchencraft Oven to Tableware
    http://kitchencraft.co.uk/brands/artesa/artesa-oven-table
  262. Kitchencraft Party Pieces
    http://kitchencraft.co.uk/brands/artesa/party-pieces
  263. Kitchencraft Perfect for Sharing
    http://kitchencraft.co.uk/brands/artesa/perfect-for-sharing
  264. Kitchencraft Serving Pots & Pans
    http://kitchencraft.co.uk/brands/artesa/serving-pots-pans
  265. Kitchencraft Setting the Table
    http://kitchencraft.co.uk/brands/artesa/setting-the-table
  266. Kitchencraft Showstopping Centrepieces
    http://kitchencraft.co.uk/brands/artesa/showstopping-centrepieces
  267. Kitchencraft Slate Serving
    http://kitchencraft.co.uk/brands/artesa/slate-serving
  268. Kitchencraft Special Occasions
    http://kitchencraft.co.uk/brands/artesa/special-occasions
  269. Kitchencraft Wood Serving
    http://kitchencraft.co.uk/brands/artesa/wood-serving
  270. Kitchencraft BarCraft
    http://kitchencraft.co.uk/brands/barcraft
  271. Kitchencraft New from BarCraft
    http://kitchencraft.co.uk/brands/barcraft/new-barcraft
  272. Kitchencraft Bar Accessories & Storage
    http://kitchencraft.co.uk/brands/barcraft/bar-accessories-storage
  273. Kitchencraft Beer & Cider
    http://kitchencraft.co.uk/brands/barcraft/beer-cider-1
  274. Kitchencraft Cocktails & Spirits
    http://kitchencraft.co.uk/brands/barcraft/cocktails-spirits
  275. Kitchencraft Corkscrews & Openers
    http://kitchencraft.co.uk/brands/barcraft/barcraft-corkscrews-openers
  276. Kitchencraft Counter Top Displays
    http://kitchencraft.co.uk/brands/barcraft/barcraft-counter-top-displays
  277. Kitchencraft Drinkware
    http://kitchencraft.co.uk/brands/barcraft/drinkware
  278. Kitchencraft Gifts
    http://kitchencraft.co.uk/brands/barcraft/barcraft-gifts
  279. Kitchencraft Hip Flasks
    http://kitchencraft.co.uk/brands/barcraft/barcraft-hip-flasks
  280. Kitchencraft Ice Buckets, Coolers & Tongs
    http://kitchencraft.co.uk/brands/barcraft/barcraft-ice
  281. Kitchencraft Wine, Champagne & Prosecco
    http://kitchencraft.co.uk/brands/barcraft/wine-champagne-prosecco
  282. Kitchencraft Built
    http://kitchencraft.co.uk/brands/built
  283. Kitchencraft Chef'n
    http://kitchencraft.co.uk/brands/chefn
  284. Kitchencraft Fruit Prep
    http://kitchencraft.co.uk/brands/chefn/chef-fruit-prep
  285. Kitchencraft Vegetable Prep
    http://kitchencraft.co.uk/brands/chefn/chef-vegetable-prep
  286. Kitchencraft Herbs & Spices
    http://kitchencraft.co.uk/brands/chefn/chef-herbs-spices
  287. Kitchencraft Graters and Scissors
    http://kitchencraft.co.uk/brands/chefn/chef-graters-scissors
  288. Kitchencraft Tools & Gadgets
    http://kitchencraft.co.uk/brands/chefn/chef-tools-gadgets
  289. Kitchencraft Chicago Metallic
    http://kitchencraft.co.uk/brands/chicago-metallic
  290. Kitchencraft Baking Accessories
    http://kitchencraft.co.uk/brands/chicago-metallic/chicago-metallic-baking
  291. Kitchencraft Brownies & Cookies
    http://kitchencraft.co.uk/brands/chicago-metallic/chicago-metallic-brownies-cookies
  292. Kitchencraft Cake Pans
    http://kitchencraft.co.uk/brands/chicago-metallic/chicago-metallic-cake-pans
  293. Kitchencraft Loaf Pans
    http://kitchencraft.co.uk/brands/chicago-metallic/chicago-metallic-loaf-pans
  294. Kitchencraft Muffin Pans
    http://kitchencraft.co.uk/brands/chicago-metallic/chicago-metallic-muffins
  295. Kitchencraft Pizza Pans & Crispers
    http://kitchencraft.co.uk/brands/chicago-metallic/chicago-metallic-pizza
  296. Kitchencraft Roasting
    http://kitchencraft.co.uk/brands/chicago-metallic/chicago-metallic-roasting
  297. Kitchencraft Colourworks
    http://kitchencraft.co.uk/brands/colourworks
  298. Kitchencraft New from Colourworks
    http://kitchencraft.co.uk/brands/colourworks/new-colourworks
  299. Kitchencraft Colourworks Brights
    http://kitchencraft.co.uk/brands/colourworks/colourworks-brights
  300. Kitchencraft Colourworks Classics
    http://kitchencraft.co.uk/brands/colourworks/colourworks-classics
  301. Kitchencraft Colourworks Originals
    http://kitchencraft.co.uk/brands/colourworks/colourworks-originals
  302. Kitchencraft Accessories
    http://kitchencraft.co.uk/brands/colourworks/accessories-colourworks
  303. Kitchencraft Counter Top Displays
    http://kitchencraft.co.uk/brands/colourworks/counter-top-displays
  304. Kitchencraft Dinnerware
    http://kitchencraft.co.uk/brands/colourworks/dinnerware
  305. Kitchencraft Knives & Cutting
    http://kitchencraft.co.uk/brands/colourworks/colourworks-knives-cutting
  306. Kitchencraft Measuring
    http://kitchencraft.co.uk/brands/colourworks/measuring
  307. Kitchencraft Tools
    http://kitchencraft.co.uk/brands/colourworks/tools
  308. Kitchencraft Creative Tops
    http://kitchencraft.co.uk/brands/creative-tops
  309. Kitchencraft Fred
    http://kitchencraft.co.uk/brands/fred
  310. Kitchencraft Table
    http://kitchencraft.co.uk/brands/fred/fred-table
  311. Kitchencraft Home Made
    http://kitchencraft.co.uk/brands/homemade
  312. Kitchencraft Accessories
    http://kitchencraft.co.uk/brands/homemade/home-made-accessories
  313. Kitchencraft Bread Making
    http://kitchencraft.co.uk/brands/homemade/home-made-bread-making
  314. Kitchencraft Clip Top Jars
    http://kitchencraft.co.uk/brands/homemade/clip-top-jars
  315. Kitchencraft Drinks & Cordials
    http://kitchencraft.co.uk/brands/homemade/drinks-and-cordials
  316. Kitchencraft Herbs and Spices
    http://kitchencraft.co.uk/brands/homemade/herbs-and-spices
  317. Kitchencraft Home Cooking
    http://kitchencraft.co.uk/brands/homemade/home-cooking
  318. Kitchencraft Glass Jars & Bottles
    http://kitchencraft.co.uk/brands/homemade/glass-jars-bottles
  319. Kitchencraft Mixing Bowls & Basins
    http://kitchencraft.co.uk/brands/homemade/home-made-mixing-bowls-basins
  320. Kitchencraft Preserving
    http://kitchencraft.co.uk/brands/homemade/preserving
  321. Kitchencraft KitchenCraft
    http://kitchencraft.co.uk/brands/kitchencraft
  322. Kitchencraft Bakeware
    http://kitchencraft.co.uk/brands/kitchencraft/kitchen-craft-bakeware
  323. Kitchencraft Bowls
    http://kitchencraft.co.uk/brands/kitchencraft/kitchen-craft-bowls
  324. Kitchencraft Chopping Boards
    http://kitchencraft.co.uk/brands/kitchencraft/kitchen-craft-chopping-boards
  325. Kitchencraft Cleaning & Sink Solutions
    http://kitchencraft.co.uk/brands/kitchencraft/kitchen-craft-cleaning
  326. Kitchencraft Colanders & Strainers
    http://kitchencraft.co.uk/brands/kitchencraft/kitchen-craft-colanders-strainers
  327. Kitchencraft Cookware
    http://kitchencraft.co.uk/brands/kitchencraft/kitchen-craft-cookware
  328. Kitchencraft Cutters
    http://kitchencraft.co.uk/brands/kitchencraft/kitchen-craft-cutters
  329. Kitchencraft Egg Cups
    http://kitchencraft.co.uk/brands/kitchencraft/kitchencraft-egg-cups
  330. Kitchencraft Espresso Cups
    http://kitchencraft.co.uk/brands/kitchencraft/kitchen-craft-espresso-cups
  331. Kitchencraft Healthy Eating
    http://kitchencraft.co.uk/brands/kitchencraft/kitchen-craft-healthy-eating
  332. Kitchencraft Knives, Cutlery & Cutting
    http://kitchencraft.co.uk/brands/kitchencraft/kitchen-craft-knives-cutlery-cutting
  333. Kitchencraft Microwave
    http://kitchencraft.co.uk/brands/kitchencraft/kitchen-craft-microwave
  334. Kitchencraft Mini-Mugs
    http://kitchencraft.co.uk/brands/kitchencraft/kitchencraft-mini-mugs
  335. Kitchencraft Moulds
    http://kitchencraft.co.uk/brands/kitchencraft/kitchen-craft-moulds
  336. Kitchencraft Mugs
    http://kitchencraft.co.uk/brands/kitchencraft/kitchen-craft-mugs
  337. Kitchencraft Novelty
    http://kitchencraft.co.uk/brands/kitchencraft/kitchen-novelty
  338. Kitchencraft Oven Gloves, Tea Towels & Aprons
    http://kitchencraft.co.uk/brands/kitchencraft/kitchencraft-textiles
  339. Kitchencraft Oven to Tableware
    http://kitchencraft.co.uk/brands/kitchencraft/kitchen-craft-oven-to-tableware
  340. Kitchencraft Pastry
    http://kitchencraft.co.uk/brands/kitchencraft/kitchen-craft-pastry
  341. Kitchencraft Placemats & Coasters
    http://kitchencraft.co.uk/brands/kitchencraft/kitchen-craft-placemats-coasters
  342. Kitchencraft Planters
    http://kitchencraft.co.uk/brands/kitchencraft/kitchencraft-planters
  343. Kitchencraft Storage
    http://kitchencraft.co.uk/brands/kitchencraft/kitchen-craft-storage
  344. Kitchencraft Tabletop Accessories
    http://kitchencraft.co.uk/brands/kitchencraft/kitchen-craft-tabletop-accessories
  345. Kitchencraft Thermometers
    http://kitchencraft.co.uk/brands/kitchencraft/kitchen-craft-thermometers
  346. Kitchencraft Timers & Clocks
    http://kitchencraft.co.uk/brands/kitchencraft/kitchen-craft-timers-clocks
  347. Kitchencraft Tools & Gadgets
    http://kitchencraft.co.uk/brands/kitchencraft/kitchen-craft-tools-gadgets
  348. Kitchencraft Weighing & Measuring
    http://kitchencraft.co.uk/brands/kitchencraft/kitchencraft-weighing-measuring
  349. Kitchencraft Worktop Protectors & Trivets
    http://kitchencraft.co.uk/brands/kitchencraft/kitchen-trivets
  350. Kitchencraft La Cafetière
    http://kitchencraft.co.uk/brands/la-cafetiere
  351. Kitchencraft Le’Xpress
    http://kitchencraft.co.uk/brands/lexpress
  352. Kitchencraft Accessories
    http://kitchencraft.co.uk/brands/lexpress/le-xpress-accessories
  353. Kitchencraft Kettles
    http://kitchencraft.co.uk/brands/lexpress/kettles-2
  354. Kitchencraft Tea
    http://kitchencraft.co.uk/brands/lexpress/tea
  355. Kitchencraft Coffee
    http://kitchencraft.co.uk/brands/lexpress/coffee
  356. Kitchencraft London Pottery
    http://kitchencraft.co.uk/brands/london-pottery
  357. Kitchencraft MasterClass
    http://kitchencraft.co.uk/brands/masterclass
  358. Kitchencraft Tipless Knives
    http://kitchencraft.co.uk/brands/masterclass/tipless-knives
  359. Kitchencraft Smart Stack Bakeware
    http://kitchencraft.co.uk/brands/masterclass/smart-stack-bakeware
  360. Kitchencraft Smart Ceramic
    http://kitchencraft.co.uk/brands/masterclass/smart-ceramic
  361. Kitchencraft Bakeware
    http://kitchencraft.co.uk/brands/masterclass/bakeware-2
  362. Kitchencraft Crusty Bakeware
    http://kitchencraft.co.uk/brands/masterclass/master-class-crusty-bakeware
  363. Kitchencraft Silicone Flexible Bakeware
    http://kitchencraft.co.uk/brands/masterclass/silicone-flexible-bakeware
  364. Kitchencraft Cast Aluminium Cookware
    http://kitchencraft.co.uk/brands/masterclass/cast-aluminium-cookware
  365. Kitchencraft Casserole Dishes
    http://kitchencraft.co.uk/brands/masterclass/casserole-dishes
  366. Kitchencraft Cookware
    http://kitchencraft.co.uk/brands/masterclass/cookware
  367. Kitchencraft Smart Space
    http://kitchencraft.co.uk/brands/masterclass/smart-space
  368. Kitchencraft Edgekeeper Knives
    http://kitchencraft.co.uk/brands/masterclass/edgekeeper-knives
  369. Kitchencraft Knives & Cutting
    http://kitchencraft.co.uk/brands/masterclass/knives-and-cutting-cutlery
  370. Kitchencraft Tools & Gadgets
    http://kitchencraft.co.uk/brands/masterclass/tools-gadgets-1
  371. Kitchencraft Kitchen Accessories
    http://kitchencraft.co.uk/brands/masterclass/kitchen-accessories
  372. Kitchencraft Salt & Pepper
    http://kitchencraft.co.uk/brands/masterclass/salt-pepper
  373. Kitchencraft Serving
    http://kitchencraft.co.uk/brands/masterclass/serving-1
  374. Kitchencraft Cutlery
    http://kitchencraft.co.uk/brands/masterclass/masterclass-cutlery
  375. Kitchencraft Sink Solutions
    http://kitchencraft.co.uk/brands/masterclass/masterclass-sink
  376. Kitchencraft Metallics
    http://kitchencraft.co.uk/brands/masterclass/metallics
  377. Kitchencraft Maxwell & Williams
    http://kitchencraft.co.uk/brands/maxwell-williams
  378. Kitchencraft Mikasa
    http://kitchencraft.co.uk/brands/mikasa
  379. Kitchencraft Rabbit
    http://kitchencraft.co.uk/brands/rabbit
  380. Kitchencraft Corkscrews
    http://kitchencraft.co.uk/brands/rabbit/rabbit-corkscrews
  381. Kitchencraft Cutters, Pourers and Stoppers
    http://kitchencraft.co.uk/brands/rabbit/rabbit-cutters-pourers-stoppers
  382. Kitchencraft Preservers
    http://kitchencraft.co.uk/brands/rabbit/rabbit-preservers
  383. Kitchencraft Sabatier
    http://kitchencraft.co.uk/brands/sabatier
  384. Kitchencraft Sweetly Does It
    http://kitchencraft.co.uk/brands/sweetly-does-it
  385. Kitchencraft Accessories
    http://kitchencraft.co.uk/brands/sweetly-does-it/accessories
  386. Kitchencraft Bakeware
    http://kitchencraft.co.uk/brands/sweetly-does-it/bakeware-3
  387. Kitchencraft Baking & Decorating Tools
    http://kitchencraft.co.uk/brands/sweetly-does-it/baking-decorating-tools
  388. Kitchencraft Cake Stands, Covers & Carriers
    http://kitchencraft.co.uk/brands/sweetly-does-it/cake-stands-covers-carriers
  389. Kitchencraft Cake Pops
    http://kitchencraft.co.uk/brands/sweetly-does-it/cakepops
  390. Kitchencraft Chocolate Making
    http://kitchencraft.co.uk/brands/sweetly-does-it/chocolate-making
  391. Kitchencraft Cookie & Pastry Cutters
    http://kitchencraft.co.uk/brands/sweetly-does-it/cookie-pastry-cutters
  392. Kitchencraft Fondant Cutters & Moulds
    http://kitchencraft.co.uk/brands/sweetly-does-it/fondant-cutters-moulds
  393. Kitchencraft Icing and Piping
    http://kitchencraft.co.uk/brands/sweetly-does-it/icing-bags-couplers
  394. Kitchencraft Nozzles
    http://kitchencraft.co.uk/brands/sweetly-does-it/nozzles
  395. Kitchencraft Taylor
    http://kitchencraft.co.uk/brands/taylor
  396. Kitchencraft Scales
    http://kitchencraft.co.uk/brands/taylor/scales
  397. Kitchencraft Thermometers
    http://kitchencraft.co.uk/brands/taylor/thermometers
  398. Kitchencraft Timers
    http://kitchencraft.co.uk/brands/taylor/timers-1
  399. Kitchencraft V&A
    http://kitchencraft.co.uk/brands/v-a
  400. Kitchencraft Alice in Wonderland
    http://kitchencraft.co.uk/brands/collections/alice-in-wonderland
  401. Kitchencraft Alphabet Mugs
    http://kitchencraft.co.uk/brands/collections/alphabet-mugs
  402. Kitchencraft Apple Farm
    http://kitchencraft.co.uk/brands/collections/apple-farm
  403. Kitchencraft Ava & I
    http://kitchencraft.co.uk/brands/collections/ava-i
  404. Kitchencraft Barcelona
    http://kitchencraft.co.uk/brands/collections/barcelona
  405. Kitchencraft Classic Collection
    http://kitchencraft.co.uk/brands/collections/classic-collection
  406. Kitchencraft Cole Collection
    http://kitchencraft.co.uk/brands/collections/cole-collection
  407. Kitchencraft Drift
    http://kitchencraft.co.uk/brands/collections/drift
  408. Kitchencraft Earlstree & Co
    http://kitchencraft.co.uk/brands/collections/earlstree-co
  409. Kitchencraft Industrial Kitchen
    http://kitchencraft.co.uk/brands/collections/industrial-kitchen
  410. Kitchencraft Into The Wild
    http://kitchencraft.co.uk/brands/collections/into-the-wild
  411. Kitchencraft Living Nostalgia
    http://kitchencraft.co.uk/brands/collections/living-nostalgia
  412. Kitchencraft Lovello
    http://kitchencraft.co.uk/brands/collections/lovello
  413. Kitchencraft Natural Elements
    http://kitchencraft.co.uk/brands/collections/natural-elements
  414. Kitchencraft Nonsense Alphabet
    http://kitchencraft.co.uk/brands/collections/nonsense-alphabet
  415. Kitchencraft Serenity
    http://kitchencraft.co.uk/brands/collections/serenity
  416. Kitchencraft World of Flavours
    http://kitchencraft.co.uk/brands/collections/world-of-flavours
  417. Kitchencraft Occasions
    http://kitchencraft.co.uk/occasions
  418. Kitchencraft Themes
    http://kitchencraft.co.uk/occasions/themes
  419. Kitchencraft Afternoon Tea
    http://kitchencraft.co.uk/occasions/themes/afternoon-tea
  420. Kitchencraft Asparagus Season
    http://kitchencraft.co.uk/occasions/themes/asparagus-season
  421. Kitchencraft Back to School
    http://kitchencraft.co.uk/occasions/themes/back-to-school
  422. Kitchencraft Bank Holiday
    http://kitchencraft.co.uk/occasions/themes/bank-holiday
  423. Kitchencraft Barbecue
    http://kitchencraft.co.uk/occasions/themes/barbeque
  424. Kitchencraft Beer Garden
    http://kitchencraft.co.uk/occasions/themes/beer-garden
  425. Kitchencraft Birthday Parties
    http://kitchencraft.co.uk/occasions/themes/birthday-parties
  426. Kitchencraft Bonfire Night
    http://kitchencraft.co.uk/occasions/themes/bonfire-night
  427. Kitchencraft Bread Making
    http://kitchencraft.co.uk/occasions/themes/bread-making
  428. Kitchencraft Butcher's Week
    http://kitchencraft.co.uk/occasions/themes/butchers-week
  429. Kitchencraft Chinese New Year
    http://kitchencraft.co.uk/occasions/themes/chinese-new-year
  430. Kitchencraft Christmas - Bake Up A Treat
    http://kitchencraft.co.uk/occasions/themes/christmas-bake-up-a-treat
  431. Kitchencraft Christmas - Big Day Breakfast
    http://kitchencraft.co.uk/occasions/themes/xmas-big-day-breakfast
  432. Kitchencraft Christmas - Big Day Cooking
    http://kitchencraft.co.uk/occasions/themes/xmas-big-day-cooking
  433. Kitchencraft Christmas - Big Day Entertaining
    http://kitchencraft.co.uk/occasions/themes/xmas-festive-entertaining
  434. Kitchencraft Christmas - Leftovers
    http://kitchencraft.co.uk/occasions/themes/christmas-leftovers
  435. Kitchencraft Christmas - Drink & Be Merry
    http://kitchencraft.co.uk/occasions/themes/xmas-drink-merry
  436. Kitchencraft Christmas - Party Time
    http://kitchencraft.co.uk/occasions/themes/xmas-party
  437. Kitchencraft Christmas - Prep The Veggies
    http://kitchencraft.co.uk/occasions/themes/xmas-prep-the-veggies
  438. Kitchencraft Christmas - Set The Table
    http://kitchencraft.co.uk/occasions/themes/christmas-set-the-table
  439. Kitchencraft Cocktail Parties
    http://kitchencraft.co.uk/occasions/themes/cocktail-parties
  440. Kitchencraft Coffee Morning
    http://kitchencraft.co.uk/occasions/themes/occasion-coffee-morning
  441. Kitchencraft Dinner Parties
    http://kitchencraft.co.uk/occasions/themes/dinner-parties
  442. Kitchencraft Easter
    http://kitchencraft.co.uk/occasions/themes/easter
  443. Kitchencraft Easter Baking
    http://kitchencraft.co.uk/occasions/themes/easter-baking
  444. Kitchencraft Eco Friendly
    http://kitchencraft.co.uk/occasions/themes/eco-friendly
  445. Kitchencraft Entertaining
    http://kitchencraft.co.uk/occasions/themes/occasions-entertaining
  446. Kitchencraft Father's Day
    http://kitchencraft.co.uk/occasions/themes/fathers-day
  447. Kitchencraft Festivals
    http://kitchencraft.co.uk/occasions/themes/festivals
  448. Kitchencraft Festive Baking
    http://kitchencraft.co.uk/occasions/themes/festive-baking
  449. Kitchencraft Gardening
    http://kitchencraft.co.uk/occasions/themes/gardening
  450. Kitchencraft Gifts
    http://kitchencraft.co.uk/occasions/themes/occasions-gifts
  451. Kitchencraft Gifts for Him
    http://kitchencraft.co.uk/occasions/themes/gifts-for-him
  452. Kitchencraft Gifts for Her
    http://kitchencraft.co.uk/occasions/themes/gifts-for-her
  453. Kitchencraft Gifts for Kids
    http://kitchencraft.co.uk/occasions/themes/gifts-for-kids
  454. Kitchencraft Great British Beef Week
    http://kitchencraft.co.uk/occasions/themes/great-british-beef-week
  455. Kitchencraft Halloween for Groaaan-Ups
    http://kitchencraft.co.uk/occasions/themes/halloween-groan-ups
  456. Kitchencraft Harvest
    http://kitchencraft.co.uk/occasions/themes/harvest
  457. Kitchencraft Healthy Eating
    http://kitchencraft.co.uk/occasions/themes/healthy-eating
  458. Kitchencraft Healthy Food
    http://kitchencraft.co.uk/occasions/themes/healthy-food
  459. Kitchencraft Healthy Hydration
    http://kitchencraft.co.uk/occasions/themes/healthy-hydration
  460. Kitchencraft In Season - Spring
    http://kitchencraft.co.uk/occasions/themes/in-season-spring
  461. Kitchencraft In Season - Summer
    http://kitchencraft.co.uk/occasions/themes/in-season-summer
  462. Kitchencraft In Season - Autumn
    http://kitchencraft.co.uk/occasions/themes/in-season-autumn
  463. Kitchencraft In Season - Winter
    http://kitchencraft.co.uk/occasions/themes/in-season-winter
  464. Kitchencraft Indian Cuisine
    http://kitchencraft.co.uk/occasions/themes/indian-cuisine
  465. Kitchencraft Kids Parties
    http://kitchencraft.co.uk/occasions/themes/kids-parties
  466. Kitchencraft Making Pancakes
    http://kitchencraft.co.uk/occasions/themes/making-pancakes
  467. Kitchencraft Mother's Day Gifts
    http://kitchencraft.co.uk/occasions/themes/mothers-day-gifts
  468. Kitchencraft Mother's Day Preparation & Essentials
    http://kitchencraft.co.uk/occasions/themes/mothers-day
  469. Kitchencraft National Pie Week
    http://kitchencraft.co.uk/occasions/themes/national-pie-week
  470. Kitchencraft New Year's Eve Party
    http://kitchencraft.co.uk/occasions/themes/new-years-eve-party
  471. Kitchencraft Pasta Making
    http://kitchencraft.co.uk/occasions/themes/pasta-making
  472. Kitchencraft Picnics & Outdoors
    http://kitchencraft.co.uk/occasions/themes/picnics-outdoors
  473. Kitchencraft Preserving
    http://kitchencraft.co.uk/occasions/themes/preserving-2
  474. Kitchencraft Romantic
    http://kitchencraft.co.uk/occasions/themes/valentines
  475. Kitchencraft Secret Santa Gifts and Stocking Fillers
    http://kitchencraft.co.uk/occasions/themes/secret-santa-gifts-and-stocking-fillers
  476. Kitchencraft School's out
    http://kitchencraft.co.uk/occasions/themes/schools-out
  477. Kitchencraft Sloe Gin
    http://kitchencraft.co.uk/occasions/themes/sloe-gin
  478. Kitchencraft Space Saving
    http://kitchencraft.co.uk/occasions/themes/space-saving
  479. Kitchencraft Spring Cleaning
    http://kitchencraft.co.uk/occasions/themes/spring-cleaning
  480. Kitchencraft Staycation
    http://kitchencraft.co.uk/occasions/themes/staycation
  481. Kitchencraft Time to Bake
    http://kitchencraft.co.uk/occasions/themes/time-to-bake
  482. Kitchencraft Time Savers
    http://kitchencraft.co.uk/occasions/themes/time-savers
  483. Kitchencraft Trend - A Thoughtful Home
    http://kitchencraft.co.uk/occasions/themes/a-thoughtful-home
  484. Kitchencraft Trend - Back to Black
    http://kitchencraft.co.uk/occasions/themes/back-to-black
  485. Kitchencraft Trend - Midnight Luxe
    http://kitchencraft.co.uk/occasions/themes/midnight-luxe
  486. Kitchencraft University
    http://kitchencraft.co.uk/occasions/themes/university
  487. Kitchencraft Valentines Day - Gifts for Her
    http://kitchencraft.co.uk/occasions/themes/valentines-day-gifts-for-her
  488. Kitchencraft Valentines Day - Gifts for Him
    http://kitchencraft.co.uk/occasions/themes/valentines-day-gifts-for-him
  489. Kitchencraft Vegetarian
    http://kitchencraft.co.uk/occasions/themes/vegetarian
  490. Kitchencraft Weddings
    http://kitchencraft.co.uk/occasions/themes/weddings
  491. Kitchencraft Wimbledon
    http://kitchencraft.co.uk/occasions/themes/wimbledon
  492. Kitchencraft Winter Warmers
    http://kitchencraft.co.uk/occasions/themes/winter-warmers
  493. Kitchencraft World Cooking
    http://kitchencraft.co.uk/occasions/themes/world-cooking
  494. Kitchencraft Occasions
    http://kitchencraft.co.uk/occasions/occasion-themes
  495. http://kitchencraft.co.uk/occasions/occasion-themes/healthy-eating-trends-for-2020
    http://kitchencraft.co.uk/occasions/occasion-themes/healthy-eating-trends-for-2020
  496. http://kitchencraft.co.uk/occasions/occasion-themes/autumn-winter-barcraft
    http://kitchencraft.co.uk/occasions/occasion-themes/autumn-winter-barcraft
  497. http://kitchencraft.co.uk/occasions/occasion-themes/autumn-winter-2017
    http://kitchencraft.co.uk/occasions/occasion-themes/autumn-winter-2017
  498. http://kitchencraft.co.uk/occasions/occasion-themes/bbq-season
    http://kitchencraft.co.uk/occasions/occasion-themes/bbq-season
  499. http://kitchencraft.co.uk/occasions/occasion-themes/healthy-eating
    http://kitchencraft.co.uk/occasions/occasion-themes/healthy-eating
  500. http://kitchencraft.co.uk/occasions/occasion-themes/home-made
    http://kitchencraft.co.uk/occasions/occasion-themes/home-made
  501. http://kitchencraft.co.uk/occasions/occasion-themes/living-a-vintage-dream
    http://kitchencraft.co.uk/occasions/occasion-themes/living-a-vintage-dream
  502. http://kitchencraft.co.uk/occasions/occasion-themes/the-sugar-craft-series
    http://kitchencraft.co.uk/occasions/occasion-themes/the-sugar-craft-series
  503. http://kitchencraft.co.uk/occasions/occasion-themes/the-sugarcraft-series-ii
    http://kitchencraft.co.uk/occasions/occasion-themes/the-sugarcraft-series-ii
  504. Kitchencraft Discover & Inspire
    http://kitchencraft.co.uk/customer/discover
  505. Kitchencraft About KitchenCraft With 168 years of experience we know the trends that are going to continue to make your kitchen the heart of the home, and we have the awards to prove it! Read more
    http://kitchencraft.co.uk/customer/about
  506. Kitchencraft The Perfect Occasion! Don't sweat it, we'll help you find the perfect products for the perfect occasion! Read more
    http://kitchencraft.co.uk/occasions
  507. Kitchencraft Find Inspiration Find the latest inspirational ideas from us all throughout the year – from delicious recipes to entertaining friends and family, plus tips and gift guides! Read more
    http://kitchencraft.co.uk/customer/discover
  508. Kitchencraft Tools just got an upgrade...
    http://kitchencraft.co.uk/articles/getting_to_grips_with_kitchen_tools.htm
  509. Kitchencraft Easy to make Antioxidant Juice!
    http://kitchencraft.co.uk/customer/videos/122/4229
  510. Kitchencraft View all videos
    http://kitchencraft.co.uk/customer/videos
  511. Kitchencraft Browse all stockists
    http://kitchencraft.co.uk/locations
  512. Kitchencraft Contact
    http://kitchencraft.co.uk/customer/contact
  513. Kitchencraft Forgot your password? Click here
    http://kitchencraft.co.uk/account#showpassword
  514. Kitchencraft Register for Market Place
    http://kitchencraft.co.uk/account#showregistration
  515. Kitchencraft Cook with confidence! Whether you're cooking a daily meal for the family, or baking sweet treats like Swiss rolls, brownies and cookies. 
    http://kitchencraft.co.uk/brands/masterclass
  516. Kitchencraft Quickly add an extra 1 , 3 or five minutes to your countdown! Explore
    http://kitchencraft.co.uk/brands/taylor
  517. Kitchencraft Create beautiful traditional sweet filled festive cookies that would look charming hanging off your Christmas tree. Explore
    http://kitchencraft.co.uk/brands/sweetly-does-it
  518. Kitchencraft Explore
    http://kitchencraft.co.uk/occasions/themes/time-to-bake
  519. Kitchencraft Explore
    http://kitchencraft.co.uk/occasions/themes/halloween
  520. Kitchencraft Explore
    http://kitchencraft.co.uk/articles/flapjack.htm
  521. Kitchencraft Get more inspiration
    http://kitchencraft.co.uk/customer/discover
  522. Kitchencraft View Product
    http://kitchencraft.co.uk/categories/baking/bakeware-1/non-stick-35cm-x-25cm-baking-tray-kcmchb23.htm
  523. Kitchencraft View Product
    http://kitchencraft.co.uk/categories/novelty-gifts/gifts-by-occasion/christmas/sweetly-does-it-christmas-stained-glass-window-cookie-cutters.htm
  524. Kitchencraft View Product
    http://kitchencraft.co.uk/brands/taylor/timers-1/taylor-pro-just-another-minute-digital-timer.htm
  525. Kitchencraft Read our story
    http://kitchencraft.co.uk/customer/about
  526. Kitchencraft Help & FAQs
    http://kitchencraft.co.uk/customer
  527. Kitchencraft Product Care & Use
    http://kitchencraft.co.uk/customer/care
  528. Kitchencraft Product User Videos
    http://kitchencraft.co.uk/customer/videos
  529. Kitchencraft Product Help & Feedback
    http://kitchencraft.co.uk/customer/contact
  530. Kitchencraft Place an Order
    http://kitchencraft.co.uk/cart
  531. Kitchencraft Sign In or Register
    http://kitchencraft.co.uk/account
  532. Kitchencraft Track an Order
    http://kitchencraft.co.uk/account/orders
  533. Kitchencraft View Credit
    http://kitchencraft.co.uk/account/details
  534. Kitchencraft Our Story
    http://kitchencraft.co.uk/customer/about
  535. Kitchencraft Brands
    http://kitchencraft.co.uk/brands
  536. Kitchencraft News & Blog
    http://kitchencraft.co.uk/news
  537. Kitchencraft Awards
    http://kitchencraft.co.uk/customer/about#awards
  538. Kitchencraft Terms & Conditions
    http://kitchencraft.co.uk/customer/pages/termsandconditions
  539. Kitchencraft Terms of Use
    http://kitchencraft.co.uk/customer/pages/terms
  540. Kitchencraft Privacy & Cookies
    http://kitchencraft.co.uk/customer/pages/privacy
  541. Kitchencraft Sitemap
    http://kitchencraft.co.uk/sitemap
  542. Kitchencraft Become a Stockist
    http://kitchencraft.co.uk/customer/stockists
  543. Kitchencraft International Sales
    http://kitchencraft.co.uk/customer/contact
  544. Kitchencraft Contact Us
    http://kitchencraft.co.uk/customer/contact
  545. Kitchencraft Company Statement
    http://kitchencraft.co.uk/customer/pages/companystatement
  546. Kitchencraft More about newsletter signup
    http://kitchencraft.co.uk/customer/pages/privacy
  547. Kitchencraft cookie
    http://kitchencraft.co.uk/customer/pages/cookies
  548. Kitchencraft privacy policy
    http://kitchencraft.co.uk/customer/pages/privacy

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Kitchencraft.co.uk

busyanimatingbagsfunction navigate1cutlery500 sinecolourworks the swipproductknives ampupdatesizecoasterssolutionsgloves tea2whiskustools ampbakingcupsshowslideindexyearbakesiliconewindowclearintervaltransitionintervalpanhimfruitbakewarebig daylinksherpxfollow usrackstimersbowlscast aluminium 26cm1cookiestockistcakeknives amp cuttingknifepartyback to tophealthyfry pan colourworksvegetablecast aluminiumpan colourworksapronsclosenavitemsbarcelona coffeegifts for hercollectionstrend3warmersbowl scrapertea towelstweeningstarteggexploreyourcuttersmakepopuplinksremoveclassactiveaprons oventeaamp pepperessentialsplayvideoindexdirectioniconscrolldowneachfunctionelgadgetsknivesfalse varbinsentertainingcheckpositionnavigate1kitchenaluminium 26cmspace savingstandsclick functioncoffee cupfindfry pangooglelangcurrentlanguagebacktotopfunctiontweeningstart slideglovesfunctionenullview productspaceelsechristmas big dayoven to tablewaretablewarefunctioneventtinsoccasionsfavourites la cafetierenewview allbackanysharpamp cuttingmorebusyanimating falsetowelssinkcafetiere barcelona coffeefavouritesbarcelonamasterclass castservingfryslidesinemakingmeasuringoureatingnavigationnextcookingpartiesbread makingtimebowlread morealuminiumsalt26cm fry paninspireweekgiftspepperour favouritessearchbreadmasterclassgifts for himthumbnailcontainercontactdiningtablebarcelona coffee cupbrandsamp measuringamp coasterssaucer masterclasslovermasterclass cast aluminiumreadfootersettimeoutfunctioneventstopvarproductsnewslide slideslengthaluminium 26cm frywinekidsnewslide 0daysaucer masterclass castmugs26cm fryreturnviewbottlesgooglelangnewlanguagefunctionevent eventstopnewslidethumbnailscurrentslideaddclassselected0cookwareclosethumbnailslengthcheckwindowwidthscrolldowndirection ifsaucerprepcolourworkscompleteif thumbnailslengthslideslengthstorycastcup and saucertoppanslocationoutseasonboardsscrapermanualupdateslidetools amp gadgetscurrentslidescalessalt amp peppersavingcuptrivetschristmascookiescoffeeif thumbnailslength 0ovengloves tea towelsthumbnailslength 0bignavigationpreviouscafetierecuttingtruediscoverscissorstransitionintervalvaluecleaningbarswip whiskcurrentslide indexicinghavefollowallfunction varkitchencraftaccessoriesamp gadgetsifcheesefalsewindowaddeventresizeperfectchristmas bigwhisk and bowljarsthermometers26cmtrue ifswipampyousalt ampweday giftsif newslideoven glovescafetiere barcelonadrinkingclickstoragehelpmouldspreservingfoodaccountoven gloves teajuststylehomechocolatesmartpastrytoolsoccasionhealthy eatingindex currentslideuse

Longtail Keyword Density for Kitchencraft.co.uk

KeywordsOccurences
fry pan colourworks7
favourites la cafetiere7
cafetiere barcelona coffee7
barcelona coffee cup7
cup and saucer7
saucer masterclass cast7
masterclass cast aluminium7
cast aluminium 26cm7
aluminium 26cm fry7
26cm fry pan7
colourworks the swip7
whisk and bowl7
tools amp gadgets4
if thumbnailslength 04
back to top4
oven to tableware3
salt amp pepper3
knives amp cutting3
gifts for him3
gifts for her3
christmas big day3
gloves tea towels3
oven gloves tea3
view all12
cast aluminium8
saucer masterclass7
function var7
bowl scraper7
pan colourworks7
fry pan7
26cm fry7
aluminium 26cm7
masterclass cast7
swip whisk7
coffee cup7
barcelona coffee7
cafetiere barcelona7
our favourites7
direction if6
follow us5
tea towels4
amp cutting4
if thumbnailslength4
oven gloves4
thumbnailslength 04
function navigate14
big day4
index currentslide4
tweeningstart slide4
500 sine4
busyanimating false4
currentslide index4
if newslide4
click function4
newslide 04
amp gadgets4
tools amp4
newslide slideslength4
true if3
knives amp3
false var3
view product3
read more3
day gifts3
christmas big3
space saving3
bread making3
amp coasters3
healthy eating3
amp pepper3
salt amp3
amp measuring3
aprons oven3
gloves tea3
functionevent eventstop3
amp93
var45
if42
function32
accessories24
all19
018
gifts18
tools17
view16
our15
index14
storage14
new14
currentslide14
top13
us12
coffee12
colourworks12
christmas12
baking11
find11
bakeware11
true11
newslide10
cake10
cast10
updatesize10
direction10
serving9
cooking9
day9
kitchen9
knives9
cutters9
false8
busyanimating8
return8
click8
your8
aluminium8
products8
masterclass8
barcelona8
oven8
functionevent8
17
saucer7
making7
more7
closenavitems7
cafetiere7
favourites7
cookware7
swip7
26cm7
fry7
pan7
scraper7
cup7
bowl7
whisk7
tea7
back6
home6
explore6
cleaning6
product6
slideslength6
bake6
playvideo6
pans6
gadgets6
measuring6
dining6
follow5
season5
bread5
location5
sink5
jars5
kitchencraft5
25
moulds5
cutlery5
cups5
search5
healthy5
cutting5
perfect5
parties5
kids5
you4
complete4
value4
else4
read4
have4
we4
discover4
trend4
eventstop4
tweeningstart4
time4
thumbnailslength4
navigationnext4
navigationprevious4
thumbnailcontainer4
windowaddeventresize4
slide4
showslideindex4
updateslide4
34
navigate14
account4
use4
stockist4
transitioninterval4
manual4
thumbnailscurrentslideaddclassselected4
windowclearintervaltransitioninterval4
googlelangnewlanguage4
sine4
anysharp4
mugs4
stands4
solutions4
aprons4
towels4
gloves4
knife4
thermometers4
timers4
cookie4
brands4
essentials4
space4
tableware4
make4
collections4
tins4
pastry4
cookies4
big4
pepper3
vegetable3
eating3
coasters3
trivets3
warmers3
drinking3
fruit3
egg3
salt3
entertaining3
px3
scales3
bar3
racks3
chocolate3
bags3
icing3
silicone3
footer3
backtotop3
scrolldown3
icon-scroll-downeachfunctionel3
bowls3
settimeoutfunction3
bottles3
table3
lover3
null3
googlelangcurrentlanguage3
style3
just3
party3
help3
close3
occasions3
prep3
smart3
week3
inspire3
year3
occasion3
her3
popuplinksremoveclassactive3
links3
functione3
out3
wine3
cheese3
boards3
checkwindowwidth3
story3
him3
scissors3
bins3
saving3
contact3
food3
preserving3
checkposition3

Who hosts Kitchencraft.co.uk?

Kitchencraft.co.uk Hosting Provider Information

Hosted IP Address:176.34.129.129
Hosted Hostname:ec2-176-34-129-129.eu-west-1.compute.amazonaw
Service Provider:Amazon.com, Inc.
Hosted Country:IrelandIE
Location Latitude:53.3331
Location Longitude:-6.2489
Webserver Software:awselb/2.0

Is "Amazon.com, Inc." in the Top 10 Hosting Companies?

Name
Percentage
GoDaddy.com, LLC
9.5100%
DoD Network Information Center
8.4509%
Google Inc.
2.8338%
Confluence Networks Inc
2.6217%
Amazon.com, Inc.
2.1737%
Namecheap, Inc.
2.1384%
TOT Public Company Limited
1.5665%
1&1 Internet AG
1.5512%
Merit Network Inc.
1.3856%
Unified Layer
1.3043%

HTTP Header Analysis for Kitchencraft.co.uk

Http-Version: 1.1
Status-Code: 301
Status: 301 Moved Permanently
Server: awselb/2.0
Date: Thu, 29 Oct 2020 19:00:00 GMT
Content-Type: text/html
Content-Length: 134
Connection: keep-alive
Location: https://www.kitchencraft.co.uk:443//

Kitchencraft.co.uk Domain Nameserver Information

HostIP AddressCountry
ns1.livedns.co.uk 217.160.81.244
ns2.livedns.co.uk 217.160.82.244
ns3.livedns.co.uk 217.160.83.244


Need to find out who hosts Kitchencraft.co.uk?


Domain Registration (WhoIs) information for Kitchencraft.co.uk

 Domain name:
kitchencraft.co.uk

Registrant:
Thomas Plant (Birmingham) Ltd

Registrant type:
UK Limited Company, (Company number: 3411690)

Registrant's address:
Plumbob House, Valepits Road
Garretts Green
Birmingham
West Midlands
B33 0TD
United Kingdom

Data validation:
Nominet was able to match the registrant's name and address against a 3rd party data source on 13-Aug-2014

Registrar:
Fasthosts Internet Ltd [Tag = LIVEDOMAINS]
URL: http://www.fasthosts.co.uk

Relevant dates:
Registered on: 11-Sep-1997
Expiry date: 11-Sep-2018
Last updated: 12-Aug-2017

Registration status:
Registered until expiry date.

Name servers:
ns0.demon.co.uk 158.152.1.65
ns1.demon.co.uk 158.152.1.193
ns2.demon.net

WHOIS lookup made at 14:02:22 25-Oct-2017

--
This WHOIS information is provided for free by Nominet UK the central registry
for .uk domain names. This information and the .uk WHOIS are:

Copyright Nominet UK 1996 - 2017.

You may not access the .uk WHOIS or use any data from it except as permitted
by the terms of use available in full at http://www.nominet.uk/whoisterms,
which includes restrictions on: (A) use of the data for advertising, or its
repackaging, recompilation, redistribution or reuse (B) obscuring, removing
or hiding any or all of this notice and (C) exceeding query rate or volume
limits. The data is provided on an 'as-is' basis and may lag behind the
register. Access may be withdrawn or restricted at any time.

Websites with Similar Names

Kitch-bent.net
kitsch-bent, l.l.c.
Kitch-bent.org
kitsch-bent, l.l.c.
Kitch-bent.us
Site Unavailable
Kitch-encounters.com
Kitchen Remodeling Tallahassee - Kitch-Encounters Bathroom Remodeling
Kitch.top
Index of /
Kitchaletdeau.com
Stocker une eau de pluie avec le récupérateur intégré kitchaletdeau
Kitchana.com
HugeDomains.com - Shop for over 300,000 Premium Domains

Recently Updated Websites

Henicacademy.com (1 second ago.)Infycoretech.com (2 seconds ago.)Imassupre.com (3 seconds ago.)Guangmingxiyu.com (5 seconds ago.)Growinggraces.com (8 seconds ago.)Hspdigit.com (9 seconds ago.)Heraswarriors.com (12 seconds ago.)Ink-customizait.com (15 seconds ago.)Henryscollege.com (16 seconds ago.)Hemuru.com (18 seconds ago.)Hungrydark.com (20 seconds ago.)Myrecoverytips.com (20 seconds ago.)Guillotine-league.com (22 seconds ago.)Cunqian0316.com (22 seconds ago.)Hakedg.com (24 seconds ago.)Bitrixonrails.ru (24 seconds ago.)Healychakras.com (25 seconds ago.)Herbiesoil.com (26 seconds ago.)Gzxy123.com (26 seconds ago.)Inperatorebt.com (26 seconds ago.)Hotpricefunnels.com (27 seconds ago.)Ibuzzee.com (29 seconds ago.)Huiniaon.com (30 seconds ago.)Giggamusicstore.com (31 seconds ago.)Happysundayco.com (31 seconds ago.)Iamtopcoder.com (32 seconds ago.)Gkspares.com (33 seconds ago.)Heatup2020.com (33 seconds ago.)Hoteljobopenings.com (34 seconds ago.)Halunadesigns.com (36 seconds ago.)

Recently Searched Keywords

roblox uae (1 second ago.)logout (1 second ago.)خانه (2 seconds ago.)楽天せどり (2 seconds ago.)0 0 (6 seconds ago.)12 months (7 seconds ago.)renders all digital-only (9 seconds ago.)gorilla book (12 seconds ago.)getcookielangpreference (13 seconds ago.)positionfixed importantleftauto (13 seconds ago.)real father and son gay porn (14 seconds ago.)gay male incest stories (15 seconds ago.)gay incest stories tumblr (15 seconds ago.)gay incest sex tube (16 seconds ago.)didim efeler mahallesi satılık villa (16 seconds ago.)gay father and son porn videos (17 seconds ago.)gay brother incest porn (18 seconds ago.)a gay incest (18 seconds ago.)gzhlhy168 (19 seconds ago.)ebbes-travstudio (19 seconds ago.)trage (19 seconds ago.)2017 - 2018 (20 seconds ago.)false beforesend function (21 seconds ago.)desconcentrados (21 seconds ago.)女性... (22 seconds ago.)篮球在哪压球 (23 seconds ago.)硅胶干燥剂 (23 seconds ago.)y thc (31 seconds ago.)verfectcom (32 seconds ago.)back guarantee (32 seconds ago.)