Kochhelden-Home - KOCHHELDEN.TV

Safety: Low trust score
Year Founded: 2012
Global Traffic Rank: Unknown
Estimated Worth: $9
Last updated:2020-10-11
Category: This site has not been categorized yet


Domain summary

Domain label
kochhelden
Domain extension
tv
Domain registered:
2012-02-27
Domain updated:
2020-02-28
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is kochhelden.tv ranked relative to other sites:

Percentage of visits to kochhelden.tv from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Kochhelden.tv registered?
A: Kochhelden.tv was registered 8 years, 10 months, 3 weeks, 3 days, 18 hours, 41 minutes, 20 seconds ago on Monday, February 27, 2012.
Q: When was the WHOIS for Kochhelden.tv last updated?
A: The WHOIS entry was last updated 10 months, 3 weeks, 2 days, 18 hours, 41 minutes, 20 seconds ago on Friday, February 28, 2020.
Q: What are Kochhelden.tv's nameservers?
A: DNS for Kochhelden.tv is provided by the following nameservers:
  • ns5.kasserver.com
  • ns6.kasserver.com
Q: Who is the registrar for the Kochhelden.tv domain?
A: The domain has been registered at KEY-SYSTEMS GMBH.
Q: What is the traffic rank for Kochhelden.tv?
A: Kochhelden.tv has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Kochhelden.tv each day?
A: Kochhelden.tv receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Kochhelden.tv resolve to?
A: Kochhelden.tv resolves to the IPv4 address 85.13.157.81.
Q: In what country are Kochhelden.tv servers located in?
A: Kochhelden.tv has servers located in the Germany.
Q: What webserver software does Kochhelden.tv use?
A: Kochhelden.tv is powered by Apache webserver.
Q: Who hosts Kochhelden.tv?
A: Kochhelden.tv is hosted by Neue Medien Muennich GmbH in Germany.
Q: How much is Kochhelden.tv worth?
A: Kochhelden.tv has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Kochhelden.tv Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Kochhelden.tv Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Kochhelden.tv

H1 Headings

0 :

H2 Headings

47 :
  1. Spare Ribs mit Kirsch-BBQ-Sauce
  2. Blaubeer-Bananenbrot | #berryboom
  3. Süßkartoffel-Häppchen
  4. French Dressing | einfach und schnell auf Avocado-Toast
  5. Bœuf Stroganoff | Rindfleisch Stroganoff
  6. BURGER BUNS selber machen | Perfekte Brioche Burger
  7. Bester Spargelauflauf der Welt
  8. Shakshuka
  9. Bananenbrot – Backen ohne Hefe
  10. Hefe vermehren | Hefe selber machen
  11. Stir Fry Chicken | Asiatische Hühnchenpfanne
  12. Brokkoli-Pasta mit veganer Zitronen-Cashew-Soße – mit Bimi Brokkoli
  13. Hackbällchen mit Mozzarella gefüllt in selbstgemachter Tomatensoße
  14. Honig-Lachs auf asiatischen Koriandernudeln
  15. Gesündere Lebkuchen-Pfannkuchen
  16. Süßkartoffelpuffer – ein Rösti mit Süßkartoffel
  17. Blumenkohlreis – Fried Rice mit Blumenkohl
  18. Blumenkohl Mac’n’Cheese
  19. Cheeseburger-Auflauf
  20. Taboul̩ РLibanesischer Bulgursalat
  21. Videos
  22. French Dressing | einfach und schnell auf Avocado-Toast
  23. Bœuf Stroganoff | Rindfleisch Stroganoff
  24. BURGER BUNS selber machen | Perfekte Brioche Burger
  25. Bester Spargelauflauf der Welt
  26. Neueste Beiträge
  27. Spare Ribs mit Kirsch-BBQ-Sauce
  28. Blaubeer-Bananenbrot | #berryboom
  29. Süßkartoffel-Häppchen
  30. French Dressing | einfach und schnell auf Avocado-Toast
  31. Bœuf Stroganoff | Rindfleisch Stroganoff
  32. BURGER BUNS selber machen | Perfekte Brioche Burger
  33. Bester Spargelauflauf der Welt
  34. Shakshuka
  35. Bananenbrot – Backen ohne Hefe
  36. Herzlich willkommen!
  37. Kochhelden.TV auf YouTube:
  38. Kochhelden.TV ist ein Projekt der
  39. Suche:
  40. Werbung:
  41. Kochhelden bei Amazon:
  42. Beliebte Beiträge
  43. Frühlingssmoothie
  44. Pilz-Omelette {Schnelles Frühstück}
  45. Oopsies – Der Low Carb Brotersatz
  46. Eiweißbombe: Low Carb Waffeln
  47. Blogroll

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

40 :

Google Adsense

:
pub-5772946950849396

Google Analytics

:
UA-33783512-1

Links - Internal

99:

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Kochhelden.tv

selber machen perfektederausblenden akzeptieren anausfunctionnovember 2019 weiterlesenavocadotoastbunsdatenschutzerklrung httpspoliciesgooglecomprivacyschnellelbesucherstroganoffrezepte videosrezepte rezepte videosumjanuarwennfr0stroganoff rindfleisch stroganoffdieserinit function14 juniamp7akzeptieren anaus name11sindyoutubefunction contentblockerdataweiterlesen bloghauptgerichtspargelauflauf derblog rezepte12burger buns selbervegetarischnurweiterlesen blog frhstckgrillenjensgrillen amp bbqfrhstckanbieter14 juni 2020akzeptieren anausbuns selber macheninformationendenperfekte briocheburger buns1shakshukavorspeiseel contentblockerdata2020 bloganzeigen cookieinformationen ausblendeninitweiterlesen blog hauptgerichtmachen perfektedatenschutzerklrunghabefunction el contentblockerdataname googlemaizweck wird5verwendet umverwendetgrillen ampallefunction contentblockerdata initrezepte rezepte7 juni 2020zu entsperrennamefrench dressing einfachpressewirdhierbuf stroganoff rindfleischnichtanzeigen cookieinformationenso2020 weiterlesencookieinformationen anzeigen cookieinformationenfrenchbuf8buns selbermachenhostscookieinformationen ausblenden akzeptierendatenschutzeinstellungenentsperrenbananenbrotblog hauptgerichtcookie namenovembercheatmeals31 mai2019 weiterlesen blog2020 weiterlesen blogbindasrezepte vegetarischselberspargelauflauf der weltjanuar 2020 weiterlesenanaus namecontentblockerdataauf avocadotoasteinfachkochheldentv2machen perfekte briocheapril 2020 weiterlesen4facebookanaus name googleanbieter googleselber machenvegan videosmai 2020stroganoff rindfleischbesterspargelauflaufzucookieinformationen ausblendenweltbrioche burgerrezeptefr dieeinenperfekte3suchevegetarisch und vegandressing einfachcookie laufzeitses vegetarischbester spargelauflauf der9november 2019berzu entsperren datenschutzerklrunganzeigeneinistbester spargelauflaufakzeptierenhttpspoliciesgooglecomprivacyidjahre24 mai 2020weiterlesenvon googlefrench dressingel contentblockerdata settingsschnell aufmirsesobjectvideos rezeptebuf stroganoffapril 2020eineblog hauptgericht rezepteborlabscookieinitjuni 2020jens 27hefezweck wird verwendetzumodereinfach und schnelleswird verwendet umeuchinit function eldiesezweibeilagenhauptgericht rezepterindfleisch stroganoff2019 weiterlesenausblenden akzeptierenblog frhstckcookieinformationen anzeigenwerdenshowcookingwieburgersettingshauptgericht rezepte rezeptejens 19rezepte rezepte vegetarischlaufzeitreisenjuni 2020 weiterlesendressingschnell auf avocadotoastcookieinformationenentsperren datenschutzerklrungmitjunianausessenzielle cookieswird verwendetcontentblockerdata settingsichaufjens 15amp bbqcookiesvon24 maider welt8230 jens31 mai 2020vegan6januar 2020aprilgooglecontentblockerdata initbbqbriocheausblendenzweckrindfleischmedienmichsievideosfunction elaus10perfekte brioche burgercookie7 juniblogessenziellemancontentblockerdata init functionwebsiteaberdie

Longtail Keyword Density for Kochhelden.tv

KeywordsOccurences
2020 weiterlesen blog13
blog hauptgericht rezepte11
vegetarisch und vegan10
weiterlesen blog hauptgericht10
hauptgericht rezepte rezepte10
rezepte rezepte videos9
akzeptieren anaus name9
function contentblockerdata init8
function el contentblockerdata8
init function el8
rezepte rezepte vegetarisch8
contentblockerdata init function8
zweck wird verwendet6
el contentblockerdata settings6
wird verwendet um6
zu entsperren datenschutzerklrung6
anzeigen cookie-informationen ausblenden4
cookie-informationen anzeigen cookie-informationen4
2019 weiterlesen blog4
grillen amp bbq4
juni 2020 weiterlesen4
machen perfekte brioche3
ausblenden akzeptieren anaus3
weiterlesen blog frhstck3
french dressing einfach3
einfach und schnell3
schnell auf avocado-toast3
14 juni 20203
buf stroganoff rindfleisch3
anaus name google3
stroganoff rindfleisch stroganoff3
cookie-informationen ausblenden akzeptieren3
perfekte brioche burger3
7 juni 20203
burger buns selber3
buns selber machen3
november 2019 weiterlesen3
januar 2020 weiterlesen3
april 2020 weiterlesen3
24 mai 20203
spargelauflauf der welt3
bester spargelauflauf der3
selber machen perfekte3
31 mai 20203
rezepte rezepte18
weiterlesen blog17
hauptgericht rezepte15
2020 weiterlesen15
blog hauptgericht13
juni 202010
rezepte vegetarisch9
anaus name9
akzeptieren anaus9
cookie laufzeit9
cookie name9
rezepte videos9
vegan videos8
function contentblockerdata8
contentblockerdata init8
init function8
function el8
el contentblockerdata8
zweck wird7
verwendet um7
2019 weiterlesen6
contentblockerdata settings6
wird verwendet6
zu entsperren6
entsperren datenschutzerklrung6
mai 20206
jens 195
april 20205
cookie-informationen ausblenden4
anzeigen cookie-informationen4
cookie-informationen anzeigen4
blog rezepte4
buf stroganoff4
grillen amp4
amp bbq4
burger buns4
perfekte brioche4
selber machen4
14 juni3
name google3
anbieter google3
von google3
datenschutzerklrung httpspoliciesgooglecomprivacy3
31 mai3
auf avocado-toast3
stroganoff rindfleisch3
dressing einfach3
french dressing3
jens 273
blog frhstck3
videos rezepte3
schnell auf3
rindfleisch stroganoff3
ausblenden akzeptieren3
machen perfekte3
bester spargelauflauf3
ses vegetarisch3
der welt3
24 mai3
jens 153
januar 20203
november 20193
brioche burger3
2020 blog3
8230 jens3
fr die3
essenzielle cookies3
buns selber3
7 juni3
spargelauflauf der3
rezepte48
jens37
027
blog25
cookie23
videos21
weiterlesen21
name19
hauptgericht19
function18
contentblockerdata16
ich15
der15
von14
auf13
vegetarisch12
vegan12
die12
akzeptieren12
anaus12
zu12
mit11
zweck10
wird10
110
anbieter10
juni10
stroganoff9
laufzeit9
google9
datenschutzerklrung9
verwendet9
settings8
sind8
burger8
el8
cookie-informationen8
um8
hosts8
cookies8
id8
init8
euch7
fr7
entsperren7
das7
frhstck7
ein6
aber6
26
eine6
ist6
website6
36
so6
mai6
bbq6
april6
ber6
grillen6
oder5
reisen5
wie5
anzeigen5
sie5
dressing5
45
es4
den4
54
alle4
buf4
64
hefe4
ausblenden4
man4
besucher4
amp4
presse4
mich4
facebook4
ses4
vorspeise4
74
jahre4
zum4
perfekte4
wenn4
spargelauflauf4
brioche4
november4
machen4
buns4
selber4
84
object3
werden3
suche3
welt3
showcooking3
httpspoliciesgooglecomprivacy3
93
nicht3
beilagen3
bin3
shakshuka3
103
bananenbrot3
januar3
cheatmeals3
habe3
einfach3
french3
datenschutzeinstellungen3
einen3
hier3
zwei3
aus3
kochheldentv3
youtube3
rindfleisch3
dieser3
113
bester3
avocado-toast3
diese3
medien3
essenzielle3
schnell3
informationen3
123
nur3
mir3
borlabscookieinit3

Who hosts Kochhelden.tv?

Kochhelden.tv Hosting Provider Information

Hosted IP Address:85.13.157.81
Hosted Hostname:dd41516.kasserver.com
Service Provider:Neue Medien Muennich GmbH
Hosted Country:GermanyDE
Location Latitude:51.2993
Location Longitude:9.491
Webserver Software:Apache

Is "Neue Medien Muennich GmbH" in the Top 10 Hosting Companies?

Name
Percentage
GoDaddy.com, LLC
9.5100%
DoD Network Information Center
8.4509%
Google Inc.
2.8338%
Confluence Networks Inc
2.6217%
Amazon.com, Inc.
2.1737%
Namecheap, Inc.
2.1384%
TOT Public Company Limited
1.5665%
1&1 Internet AG
1.5512%
Merit Network Inc.
1.3856%
Unified Layer
1.3043%
Neue Medien Muennich GmbH
0.1557%

HTTP Header Analysis for Kochhelden.tv

Http-Version: 1.1
Status-Code: 301
Status: 301 Moved Permanently
Date: Sun, 11 Oct 2020 06:31:00 GMT
Server: Apache
Location: https://kochhelden.tv/
Cache-Control: max-age=0
Expires: Sun, 11 Oct 2020 06:31:00 GMT
Content-Length: 230
Content-Type: text/html; charset=iso-8859-1

Kochhelden.tv Domain Nameserver Information

HostIP AddressCountry
ns5.kasserver.com 85.13.128.3
ns6.kasserver.com 85.13.159.101


Need to find out who hosts Kochhelden.tv?


Domain Registration (WhoIs) information for Kochhelden.tv

 Domain Name: kochhelden.tv
Registry Domain ID: 98832753_DOMAIN_TV-VRSN
Registrar WHOIS Server: whois.rrpproxy.net
Registrar URL: www.registrygate.com
Updated Date: 2020-02-28T08:00:35Z
Creation Date: 2012-02-27T08:23:41Z
Registrar Registration Expiration Date: 2021-02-27T08:23:41Z
Registrar: Key-Systems GmbH
Registrar IANA ID: 269
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +49.68949396850
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registry Registrant ID: REDACTED FOR PRIVACY
Registrant Name: REDACTED FOR PRIVACY
Registrant Organization: REDACTED FOR PRIVACY
Registrant Street: REDACTED FOR PRIVACY
Registrant Street: REDACTED FOR PRIVACY
Registrant Street: REDACTED FOR PRIVACY
Registrant City: REDACTED FOR PRIVACY
Registrant State/Province:
Registrant Postal Code: REDACTED FOR PRIVACY
Registrant Country: DE
Registrant Phone: REDACTED FOR PRIVACY
Registrant Phone Ext: REDACTED FOR PRIVACY
Registrant Fax: REDACTED FOR PRIVACY
Registrant Fax Ext: REDACTED FOR PRIVACY
Registrant Email: Login to show email
Admin ID: REDACTED FOR PRIVACY
Admin Name: REDACTED FOR PRIVACY
Admin Organization: REDACTED FOR PRIVACY
Admin Street: REDACTED FOR PRIVACY
Admin Street: REDACTED FOR PRIVACY
Admin Street: REDACTED FOR PRIVACY
Admin City: REDACTED FOR PRIVACY
Admin State/Province: REDACTED FOR PRIVACY
Admin Postal Code: REDACTED FOR PRIVACY
Admin Country: REDACTED FOR PRIVACY
Admin Phone: REDACTED FOR PRIVACY
Admin Phone Ext: REDACTED FOR PRIVACY
Admin Fax: REDACTED FOR PRIVACY
Admin Fax Ext: REDACTED FOR PRIVACY
Admin Email: Login to show email
Tech ID: REDACTED FOR PRIVACY
Tech Name: REDACTED FOR PRIVACY
Tech Organization: REDACTED FOR PRIVACY
Tech Street: REDACTED FOR PRIVACY
Tech Street: REDACTED FOR PRIVACY
Tech Street: REDACTED FOR PRIVACY
Tech City: REDACTED FOR PRIVACY
Tech State/Province: REDACTED FOR PRIVACY
Tech Postal Code: REDACTED FOR PRIVACY
Tech Country: REDACTED FOR PRIVACY
Tech Phone: REDACTED FOR PRIVACY
Tech Phone Ext: REDACTED FOR PRIVACY
Tech Fax: REDACTED FOR PRIVACY
Tech Fax Ext: REDACTED FOR PRIVACY
Tech Email: Login to show email
Billing ID: REDACTED FOR PRIVACY
Billing Name: REDACTED FOR PRIVACY
Billing Organization: REDACTED FOR PRIVACY
Billing Street: REDACTED FOR PRIVACY
Billing Street: REDACTED FOR PRIVACY
Billing Street: REDACTED FOR PRIVACY
Billing City: REDACTED FOR PRIVACY
Billing State/Province: REDACTED FOR PRIVACY
Billing Postal Code: REDACTED FOR PRIVACY
Billing Country: REDACTED FOR PRIVACY
Billing Phone: REDACTED FOR PRIVACY
Billing Phone Ext: REDACTED FOR PRIVACY
Billing Fax: REDACTED FOR PRIVACY
Billing Fax Ext: REDACTED FOR PRIVACY
Billing Email: Login to show email
Server: ns5.kasserver.com
Name Server: ns6.kasserver.com
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System: https://wdprs.internic.net/
>>> Last update of WHOIS database: 2020-10-11T06:31:01Z

Websites with Similar Names

Kochharcanvasstore.in
Manufacturer of Industrial Tarpaulin & Waterproof Tirpal by Kochhar Canvas Store, Ambala
Kochharpropinteriors.com
Kochhar Prop Interiors
Kochhars.com
Home - BBC News
Kochhaus-am-see.net
Host Europe GmbH – kochhaus-am-see.net
Kochhaus-destille.net
Host Europe GmbH – kochhaus-destille.net
Kochhaus.de
Das begehbare Rezeptbuch | Kochhaus

Recently Updated Websites

Employca.org (1 second ago.)Moedersvoormoeders.net (2 seconds ago.)Odrichs.net (2 seconds ago.)Kabusikifree.online (3 seconds ago.)Samheilenbach.org (3 seconds ago.)Hoglets.org (3 seconds ago.)Sportresearch.org (3 seconds ago.)Sportsbizxchange.org (3 seconds ago.)Izmailova.org (3 seconds ago.)Maineprivatemoney.com (3 seconds ago.)Physicalhealth.org (4 seconds ago.)Teuslo.net (4 seconds ago.)Chainprojects.org (4 seconds ago.)Walougol.org (4 seconds ago.)Swuno.org (4 seconds ago.)Thedigitaliqpartnership.org (5 seconds ago.)Thelesstraveledpath.org (5 seconds ago.)Getmillions.online (5 seconds ago.)Postponefascism.net (6 seconds ago.)Salonbylbs.com (6 seconds ago.)Ringoffire.one (6 seconds ago.)Singleandonfire.org (6 seconds ago.)Bridgeofhopeharrisburg.org (6 seconds ago.)Blackmindsincorporated.org (6 seconds ago.)Safeinclusivesports.org (7 seconds ago.)Wildstemfarm.org (7 seconds ago.)Adventhvac.org (7 seconds ago.)Goorla.org (7 seconds ago.)Phionexville.org (8 seconds ago.)Islandshoppe.net (8 seconds ago.)

Recently Searched Keywords

fender (1 second ago.)с днем рождения (2 seconds ago.)style-igqaaw311label (3 seconds ago.)view all available (8 seconds ago.)kayne international (10 seconds ago.)0comp-k5y52a34 dir (12 seconds ago.)experiential design (14 seconds ago.)infowindowsetcontentpropdetail infowindowopenmap (21 seconds ago.)pg-w596fb6d4a0fd2-1 (22 seconds ago.)hansagarten24.de (23 seconds ago.)қр президентінің жолдауы – 2020. қолжетімді әрі сапалы білім (25 seconds ago.)text-align left width (26 seconds ago.)font-size 2vw (29 seconds ago.)emisiones (30 seconds ago.)locationpathnamereplace (32 seconds ago.)april 17, 2018 (34 seconds ago.)domaine xixtaberri (34 seconds ago.)words english words (36 seconds ago.)hansagarten24.de (36 seconds ago.)12dbi antenna (38 seconds ago.)语音控制 (39 seconds ago.)adroiteam (46 seconds ago.)[business] tilkee vient de lever 500k€ ! (48 seconds ago.)pernbsp your product39s (51 seconds ago.)recherche demploi (52 seconds ago.)castrato (56 seconds ago.)ertugrul ghazi season 2 in urdu all episodes hd download (57 seconds ago.)konyvbirodalom.hu (59 seconds ago.)haybridge frog (1 minute 2 seconds ago.)mweslide14623owlsliderboxadv item3 contenteffect (1 minute 4 seconds ago.)