Huis, appartement of villa kopen in Spanje. Je droom binnen bereik.

Safety: Low trust score
Year Founded: 2012
Global Traffic Rank: Unknown
Estimated Worth: $9
Category: This site has not been categorized yet

Immo Linea biedt u met Kopen In Spanje uw Spaanse droom binnen bereik. Wij zijn een erkend vastgoedkantoor met ruime ervaring in Belgie en Spanje.



Domain summary

Last updated
2021-05-24
Domain label
kopeninspanje
Domain extension
be
Domain registered:
2012-11-20
Domain updated:
2021-05-24
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Frequently Asked Questions (FAQ)

Q: When was Kopeninspanje.be registered?
A: Kopeninspanje.be was registered 9 years, 1 week, 4 days, 21 hours, 12 minutes, 30 seconds ago on Tuesday, November 20, 2012.
Q: When was the WHOIS for Kopeninspanje.be last updated?
A: The WHOIS entry was last updated 6 months, 1 week, 1 day, 21 hours, 12 minutes, 30 seconds ago on Monday, May 24, 2021.
Q: What are Kopeninspanje.be's nameservers?
A: DNS for Kopeninspanje.be is provided by the following nameservers:
  • www.dnsbelgium.be
Q: Who is the registrar for the Kopeninspanje.be domain?
A: The domain has been registered at DNS Belgium.
Q: What is the traffic rank for Kopeninspanje.be?
A: Kopeninspanje.be has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Kopeninspanje.be each day?
A: Kopeninspanje.be receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Kopeninspanje.be resolve to?
A: Kopeninspanje.be resolves to the IPv4 address 193.30.110.118.
Q: In what country are Kopeninspanje.be servers located in?
A: Kopeninspanje.be has servers located in the Belgium.
Q: What webserver software does Kopeninspanje.be use?
A: Kopeninspanje.be is powered by Nginx webserver.
Q: Who hosts Kopeninspanje.be?
A: Kopeninspanje.be is hosted by Willux.be N.V. in Belgium.
Q: How much is Kopeninspanje.be worth?
A: Kopeninspanje.be has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Kopeninspanje.be Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Kopeninspanje.be Free SEO Report

Website Inpage Analysis for Kopeninspanje.be

H1 Headings

1 :
  1. Jouw droom binnen bereik

H2 Headings

2 :
  1. Kopen in Spanje
  2. LINEA | Kopen in Spanje

H3 Headings

0 :

H4 Headings

10 :
  1. Aanbod
  2. Werkwijze
  3. Voorbereiding
  4. Nieuwsbrief
  5. Onze kantoren
  6. Contacteer ons
  7. Villa Christina III
  8. Appartementen Dénia Golf
  9. Elegance
  10. Villa Bijoux

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

9 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-18959307-16

Links - Internal

0:

Links - Internal (nofollow)

0:

Links - Outbound

32:

Links - Outbound (nofollow)

4:

Keyword Cloud for Kopeninspanje.be

type get asyncwpljsliderindexindex element idnamesubstring0 2 sfsearchjson1 requeststr elementnamereplacesf2tryvar tablecolumnbreakreturnwpljslider widgetidwplsearchfromboxbotencodeuricomponentvalue wpljwplsearchwidget2false functionzwplsearchcallbacks2elementnamereplacesf2 sf encodeuricomponentvalueemptyget asyncsefstr2 sf ifitemtitletextsepopiftypeof value undefinedunsefstrwpljajax urlbadkamerselementnamewidgetid parseintwidgetid0replacesfhetnone valueajax value valuexdatatype json typerequeststr elementnamereplacesf2 sftype getwplsearchwidget2cache false timeoutwpljwplsearchwidget2 idclosestlicssdisplay nonejquerysafaricheckboxwpljwplsearchwidget2get async truereturn false1 varwijfalseselectelement idelementname ifcheckedajax ajaxelementid namefunctionchecked tablecolumnencodeuricomponentvaluewpljwplsearchfromboxwpljslider widgetid rangewpljwplsearchwidget2 wpllistingpricesalevalue value 1wpldosearch2async true cachedomainidkey valueasync truevar widgetidvalue 1 requeststr30000 successsearchstrwpljwplsearchwidget2 wpllistingpricerentaliftypeoftablefieldvalue undefinedwidgetid elmidsplit widgetidtimeout 30000 successif ajax ajaxjson type get1 var tablecolumnwpljwplsearchfrombox wplsearchfromboxbotfieldtrueidclosestlicssdisplayelsecurrentcategorytablecolumntypeofelmidsplit widgetid parseintwidgetid0replacesfurl httpswwwkopeninspanjebeif namesubstring0keyforcewpllistingpricesaleif valuebreak casemettablecolumn tablecolumn1widgetid parseintwidgetid0replacesf elseidclosestlicssdisplay none valuetypevar widgetid elmidsplit3 slaapkamerssf ifelmidsplit widgetidajax ajax valuedatarequeststr elementnamereplacesf2sf encodeuricomponentvaluejeelementid name elementname2 sfhttpswwwkopeninspanjebewpcontentpluginsrealestatelistingrealtynawplassetsimgemptypngdosearchname elementnameajaxfirstparamhttpswwwkopeninspanjebesuccess functionid elementid nametablecolumn1elementnamereplacesf2 sftrue cachetimeout 30000urldatatypelineaslaapkamersasyncaanwidgetid rangefalse timeoutsf encodeuricomponentvalue wpljwplsearchwidget2value 1wpllistingpricerentalif wpljwplsearchwidget2elementnamereplacesf2elementname if namesubstring0wpljajaxwidthjson typeparseintwidgetid0replacesfurl httpswwwkopeninspanjebe datarangeparseintwidgetid0replacesf elsevalue wpljwplsearchwidget2widgetid elmidsplitvalue valuewpljwplsearchwidget2 idclosestlicssdisplaytrue cache falseelmidsplitidclosestlicssdisplay noneelementwplsearchform2visibleif ajaxvaluesop eenrequeststr3tablecolumn1 varsf if wpljwplsearchwidget2tablecolumn1 var widgetidwpljajax url httpswwwkopeninspanjebewplsearchwidgetpricefieldremoveclasswplexcludesearchwidget wpljwplsearchwidget2namesubstring0 2documentwriteeentimeoutwplsearchwidgetpricefieldremoveclasswplexcludesearchwidgetitemsdatatype jsonindex elementid elementidnamecachevalueundefined return falsefalse timeout 30000if wpljwplsearchwidget2 idclosestlicssdisplay1 requeststrundefinedparseintwidgetid0replacesf else ifcatcherrwpllistingrequeststrhttpswwwkopeninspanjebe datachildvisible5name elementname if6tablecolumn tablecolumn1 variftypeof valueundefined returnwpljsf widgetid1widgetidnoneajax valueif namesubstring0 2wplsearchwidgetpricefieldaddclasswplexcludesearchwidgetcasevarsuccesswpljsfif value 1cache falsewpltotalresultsongoing2wpljsf2selectvalue 1 valueelement id elementidgetkopenelementidifvansearchpagenamesubstring00sf241 valueelse ifnew

Longtail Keyword Density for Kopeninspanje.be

KeywordsOccurences
value value -15
ajax value value5
id elementid name5
elementid name elementname5
name elementname if5
elementname if namesubstring05
if namesubstring0 25
namesubstring0 2 sf5
2 sf if5
requeststr elementnamereplacesf2 sf5
-1 requeststr elementnamereplacesf25
value -1 requeststr5
if ajax ajax5
ajax ajax value5
tablecolumn tablecolumn1 var4
var widgetid elmidsplit4
tablecolumn1 var widgetid4
elmidsplit widgetid parseintwidgetid0replacesf4
-1 var tablecolumn4
widgetid elmidsplit widgetid4
value -1 value4
wpljslider widgetid range4
elementnamereplacesf2 sf encodeuricomponentvalue4
iftypeof value undefined4
wpljwplsearchwidget2 idclosestlicssdisplay none4
if wpljwplsearchwidget2 idclosestlicssdisplay4
sf if wpljwplsearchwidget24
parseintwidgetid0replacesf else if3
widgetid parseintwidgetid0replacesf else3
if value -13
index element id3
url httpswwwkopen-in-spanjebe data3
timeout 30000 success3
false timeout 300003
cache false timeout3
true cache false3
async true cache3
get async true3
type get async3
json type get3
datatype json type3
element id elementid3
wpljajax url httpswwwkopen-in-spanjebe3
sf encodeuricomponentvalue wpljwplsearchwidget23
idclosestlicssdisplay none value3
undefined return false3
value -110
return false7
2 sf5
wpljslider widgetid5
elementnamereplacesf2 sf5
requeststr elementnamereplacesf25
else if5
value value5
ajax value5
ajax ajax5
if ajax5
sf if5
-1 requeststr5
namesubstring0 25
break case5
elementname if5
name elementname5
elementid name5
id elementid5
if namesubstring05
index element5
var widgetid5
widgetid range4
-1 value4
widgetid parseintwidgetid0replacesf4
elmidsplit widgetid4
var tablecolumn4
-1 var4
widgetid elmidsplit4
tablecolumn1 var4
wpljsf widgetid4
tablecolumn tablecolumn14
checked tablecolumn4
iftypeof value4
false function4
value undefined4
sf encodeuricomponentvalue4
none value4
idclosestlicssdisplay none4
wpljwplsearchwidget2 idclosestlicssdisplay4
if wpljwplsearchwidget24
wpljwplsearchfrombox wplsearchfromboxbot4
type get4
parseintwidgetid0replacesf else3
undefined return3
wpljwplsearchwidget2 wpllistingpricesale3
wplsearchwidgetpricefieldremoveclasswpl-exclude-search-widget wpljwplsearchwidget23
op een3
url httpswwwkopen-in-spanjebe3
key value3
datatype json3
success function3
element id3
value wpljwplsearchwidget23
encodeuricomponentvalue wpljwplsearchwidget23
wpljajax url3
3 slaapkamers3
httpswwwkopen-in-spanjebe data3
json type3
if value3
get async3
async true3
true cache3
cache false3
false timeout3
timeout 300003
30000 success3
wpljwplsearchwidget2 wpllistingpricerental3
function44
value43
if40
var35
wpljwplsearchwidget228
widgetid20
requeststr19
false18
018
return17
iftypeof15
else14
tablecolumn12
ajax12
true11
wplsearchwidget211
undefined11
sf10
110
van10
een10
case9
29
je8
38
het8
documentwrite7
none7
id7
element6
op6
searchstr6
url6
checked6
try6
key6
elementid5
elementname5
namesubstring05
index5
data5
break5
elementnamereplacesf25
wpljslider5
field5
name5
select5
met5
wpljwplsearchfrombox5
get5
force4
tablefield4
44
aan4
dosearch4
tablecolumn14
elmidsplit4
range4
parseintwidgetid0replacesf4
wplsearchfromboxbot4
wpljsf4
x4
z4
visible4
childvisible4
unsefstr4
httpswwwkopen-in-spanjebewp-contentpluginsreal-estate-listing-realtyna-wplassetsimgemptypng4
success4
encodeuricomponentvalue4
search4
domain4
idclosestlicssdisplay4
kopen4
type4
wplsearchform23
itemtitle3
wpldosearch23
sep3
width3
linea3
wpllistingpricesale3
wplsearchwidgetpricefieldremoveclasswpl-exclude-search-widget3
wpllistingpricerental3
wplsearchwidgetpricefieldaddclasswpl-exclude-search-widget3
catcherr3
53
wplsearchcallbacks23
jquery-safari-checkbox3
empty3
wij3
values3
currentcategory3
63
wpljajax3
httpswwwkopen-in-spanjebe3
badkamers3
datatype3
json3
async3
cache3
timeout3
typeof3
wpltotalresultsongoing23
text3
slaapkamers3
new3
sefstr3
searchpage3
firstparam3
wpljsf2select3
items3
wpllistingrequeststr3

Who hosts Kopeninspanje.be?

Kopeninspanje.be Hosting Provider Information

Hosted IP Address:193.30.110.118
Hosted Hostname:aphrodite.willux.be
Service Provider:Willux.be N.V.
Hosted Country:BelgiumBE
Location Latitude:50.8509
Location Longitude:4.3447
Webserver Software:nginx

Is "Willux.be N.V." in the Top 10 Hosting Companies?

Name
Percentage
Unknown
18.1104%
GOOGLE
13.7558%
AS-26496-GO-DADDY-COM-LLC
3.6367%
NAMECHEAP-NET
3.0541%
AMAZON-AES
2.2094%
GoDaddy.com, LLC
2.0363%
UNIFIEDLAYER-AS-1
1.9078%
Fara Negar Pardaz Khuzestan
1.5654%
CONFLUENCE-NETWORK-INC
1.4231%
1&1 Internet AG
1.3177%
Willux.be N.V.
0.0001%

HTTP Header Analysis for Kopeninspanje.be

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx
Date: Mon, 24 May 2021 09:55:29 GMT
Content-Type: text/html; charset=UTF-8
Content-Length: 18677
Connection: keep-alive
Vary: Accept-Encoding
Last-Modified: Mon, 24 May 2021 08:15:27 GMT
Content-Encoding: gzip
X-Cache-Status: MISS
X-Powered-By: PleskLin
Accept-Ranges: bytes

Kopeninspanje.be Domain Nameserver Information

HostIP AddressCountry
www.dnsbelgium.be 45.60.74.42


Need to find out who hosts Kopeninspanje.be?


Domain Registration (WhoIs) information for Kopeninspanje.be

 % .be Whois Server 6.1
%
% The WHOIS service offered by DNS Belgium and the access to the records in the DNS Belgium
% WHOIS database are provided for information purposes only. It allows
% persons to check whether a specific domain name is still available or not
% and to obtain information related to the registration records of
% existing domain names.
%
% DNS Belgium cannot, under any circumstances, be held liable where the stored
% information would prove to be incomplete or inaccurate in any sense.
%
% By submitting a query you agree not to use the information made available
% to:
% - allow, enable or otherwise support the transmission of unsolicited,
% commercial advertising or other solicitations whether via email or otherwise;
% - target advertising in any possible way;
% - to cause nuisance in any possible way to the domain name holders by sending
% messages to them (whether by automated, electronic processes capable of
% enabling high volumes or other possible means).
%
% Without prejudice to the above, it is explicitly forbidden to extract, copy
% and/or use or re-utilise in any form and by any means (electronically or
% not) the whole or a quantitatively or qualitatively substantial part
% of the contents of the WHOIS database without prior and explicit permission
% by DNS Belgium, nor in any attempt thereof, to apply automated, electronic
% processes to DNS Belgium (or its systems).
%
% You agree that any reproduction and/or transmission of data for commercial
% purposes will always be considered as the extraction of a substantial
% part of the content of the WHOIS database.
%
% By submitting the query you agree to abide by this policy and accept that
% DNS Belgium can take measures to limit the use of its whois services in order to
% protect the privacy of its registrants or the integrity of the database.
%

Domain: kopeninspanje.be
Status: NOT AVAILABLE
Registered: Tue Nov 20 2012

Registrant:
Not shown, please visit www.dnsbelgium.be for webbased whois.

Registrar Technical Contacts:
Organisation: Willux.be NV
Language: nl
Phone: +32.53782575
Fax: +32.53828881

Registrar:
Name: Willux.be NV
Website: http://www.willux.be

Nameservers:
aphrodite.willux.be
hdns2.willux.be

Keys:

Flags:

Please visit www.dnsbelgium.be for more info.

Websites with Similar Names

Kopen-ipad.nl
iPad Kopen? | Goedkoopste Apple iPad online kopen via Kopen iPad .nl
Kopen-stuiterballen.nl
Stuiterballen - kopen-stuiterballen.nl -
Kopen-wonogiri.desa.id
Desa Kopen – Kecamatan Jatipurno, Kabupaten Wonogiri
Kopen.online
The domain name kopen.online is for sale
Kopen.thuisvergelijken.nl
Home - Thuisvergelijken

Recently Updated Websites

Sportscongo.com (6 seconds ago.)Cadymcclain.com (12 seconds ago.)Tradeunipoint.za.com (19 seconds ago.)Worldnontoxic.com (23 seconds ago.)Sghediao.com (24 seconds ago.)Shastaguides.com (30 seconds ago.)Itsolutionscompany.com (32 seconds ago.)Doebbertlegacycenter.com (38 seconds ago.)Jiayongdianqi.com (41 seconds ago.)Oasisgrill.com (43 seconds ago.)Tdt2019.ad (46 seconds ago.)Gens.email (46 seconds ago.)Milpitasproperties.com (48 seconds ago.)Houkac.com (50 seconds ago.)Tjkelini.com (54 seconds ago.)Egyminers.com (59 seconds ago.)M8r0wn.com (59 seconds ago.)Mindwritten.com (59 seconds ago.)Aoabet1826.com (1 minute 4 seconds ago.)Pat.hu (1 minute 7 seconds ago.)Krakhed.com (1 minute 9 seconds ago.)Alergianieto.com (1 minute 10 seconds ago.)Bitcoinfuturestrading.com (1 minute 11 seconds ago.)Koalateam.com (1 minute 14 seconds ago.)Schroderbarns.com (1 minute 17 seconds ago.)Celebinteriors.com (1 minute 20 seconds ago.)Zirkopssecurity.net (1 minute 24 seconds ago.)Dockmywatch.com (1 minute 25 seconds ago.)Softinnovatorz.com (1 minute 27 seconds ago.)Basebanking.com (1 minute 28 seconds ago.)

Recently Searched Keywords

interregnum chronicles: signal free download (1 second ago.)social networks are often referred to as (1 second ago.)s pan irenou (2 seconds ago.)alter actor (2 seconds ago.)h1font-size13pxline-height13pxmargin-bottom15pxtext-alignleftbodydslc-res-tablet dslc-content (3 seconds ago.)marita (3 seconds ago.)demeanor (3 seconds ago.)blu-gal-imgeachfunction (4 seconds ago.)neuroleptici - shizofenija - efikasnost (1) (4 seconds ago.)feng shui fame (4 seconds ago.)reached payout (5 seconds ago.)solid solidborder-radius0margin-bottom50pxmin-height0padding-top0padding-bottom0padding-left0padding-right0dslc-content (5 seconds ago.)h6font-size13pxline-height13pxmargin-bottom15pxtext-alignleftbodydslc-res-tablet dslc-content (5 seconds ago.)active fuller lifestyle (6 seconds ago.)false href (6 seconds ago.)linkek (7 seconds ago.)قدس (7 seconds ago.)our 1st anniversary (7 seconds ago.)promoção! (8 seconds ago.)documentgetelementbyidtwustyleposition absolute (9 seconds ago.)企业愿景怎么写 (9 seconds ago.)1 rpbgid (10 seconds ago.)人工投票 (11 seconds ago.)items betweem 900px (12 seconds ago.)ngay bng gi (12 seconds ago.)ночное восстановление (12 seconds ago.)about nihilism (12 seconds ago.)leftjssoreasingeaseoutwavetopjssoreasingeaseincubic (12 seconds ago.)ogrd (13 seconds ago.)h4font-size13pxline-height13pxmargin-bottom15pxtext-alignleftbodydslc-res-tablet dslc-content (13 seconds ago.)