Domain summary

Last updated
2021-06-05
Domain label
korkortsportalen
Domain extension
se
Domain registered:
2006-04-18
Domain updated:
2021-06-05
Domain expires:
2022-04-18
Global Traffic Rank
897,113
Statvoo Rating
H
Trust Score
Low Trust Score
Estimated worth
$1,440
Estimated daily income
$6
Estimated monthly income
$183

Frequently Asked Questions (FAQ)

Q: When was Korkortsportalen.se registered?
A: Korkortsportalen.se was registered 15 years, 5 months, 1 week, 21 hours, 55 minutes, 12 seconds ago on Tuesday, April 18, 2006.
Q: When was the WHOIS for Korkortsportalen.se last updated?
A: The WHOIS entry was last updated 3 months, 2 weeks, 6 days, 21 hours, 55 minutes, 12 seconds ago on Saturday, June 5, 2021.
Q: What are Korkortsportalen.se's nameservers?
A: DNS for Korkortsportalen.se is provided by the following nameservers:
  • dns1.cscdns.net
  • dns2.cscdns.net
Q: Who is the registrar for the Korkortsportalen.se domain?
A: The domain has been registered at NIC-SE.
Q: What is the traffic rank for Korkortsportalen.se?
A: Korkortsportalen.se ranks 897,113 globally on Alexa. Korkortsportalen.se has a Low Trust Score, and a Statvoo Rank of H.
Q: How many people visit Korkortsportalen.se each day?
A: Korkortsportalen.se receives approximately 977 visitors and 1,954 page impressions per day.
Q: What IP address does Korkortsportalen.se resolve to?
A: Korkortsportalen.se resolves to the IPv4 address 165.160.15.20.
Q: In what country are Korkortsportalen.se servers located in?
A: Korkortsportalen.se has servers located in the United States.
Q: What webserver software does Korkortsportalen.se use?
A: Korkortsportalen.se is powered by Microsoft-IIS/10.0 webserver.
Q: Who hosts Korkortsportalen.se?
A: Korkortsportalen.se is hosted by Corporation Service Company in United States.
Q: How much is Korkortsportalen.se worth?
A: Korkortsportalen.se has an estimated worth of $1,440. An average daily income of approximately $6, which is roughly $183 per month.

Korkortsportalen.se Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Korkortsportalen.se Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Korkortsportalen.se

H1 Headings

1 :
  1. Körkort

H2 Headings

13 :
  1. Ta körkort
  2. Information om coronaviruset och körkort
  3. Ta körkort
  4. Handledare
  5. Har körkort
  6. Förlorat körkort
  7. Företag och organisationer
  8. Trafikmedicin
  9. E-tjänster inom körkort
  10. Undersidor
  11. Relaterad information
  12. Vanliga frågor
  13. Om sidan

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

5 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

49:

Links - Internal (nofollow)

0:

Links - Outbound

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Korkortsportalen.se

hrdittellerhittar du informationochvaroch organisationerhartaavinformationmedicinskaattalkolskrkort lsvidu information omdulsdu informationkaninomtillomvad somhittar duocksdigpsynintygtrafikmedicinhr hittar dugllerdig somossinformation omrapporterahandledaresomorganisationerfrarutbildningdetv228gtrafikfordonhittark246rkortditt krkorthurvadkrkortvad som gllerhr hittarreglerjaglkarintygfrsom gller

Who hosts Korkortsportalen.se?

Korkortsportalen.se Hosting Provider Information

Hosted IP Address:165.160.15.20
Hosted Hostname:165.160.15.20
Service Provider:Corporation Service Company
Hosted Country:United StatesUS
Location Latitude:37.751
Location Longitude:-97.822
Webserver Software:Microsoft-IIS/10.0

Is "Corporation Service Company" in the Top 10 Hosting Companies?

Name
Percentage
GOOGLE
17.4810%
Unknown
8.7814%
AS-26496-GO-DADDY-COM-LLC
4.6042%
NAMECHEAP-NET
3.7023%
AMAZON-AES
2.7678%
GoDaddy.com, LLC
2.4095%
UNIFIEDLAYER-AS-1
2.4018%
Fara Negar Pardaz Khuzestan
2.0303%
CONFLUENCE-NETWORK-INC
1.7535%
1&1 Internet AG
1.6915%
Corporation Service Company
0.1088%

HTTP Header Analysis for Korkortsportalen.se

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Cache-Control: private
Content-Type: text/html; charset=utf-8
Content-Encoding: gzip
Vary: Accept-Encoding
Server: Microsoft-IIS/10.0
X-AspNetMvc-Version: 5.2
X-AspNet-Version: 4.0.30319
X-Powered-By: ASP.NET
X-UA-Compatible: IE=edge
Strict-Transport-Security: max-age=31536000
X-XSS-Protection: 1; mode=block
X-Frame-Options: SAMEORIGIN
X-Content-Type-Options: nosniff
Date: Sat, 05 Jun 2021 03:43:28 GMT
Content-Length: 7405

Korkortsportalen.se Domain Nameserver Information

HostIP AddressCountry
dns1.cscdns.net 156.154.130.100
dns2.cscdns.net 156.154.131.100


Need to find out who hosts Korkortsportalen.se?


Domain Registration (WhoIs) information for Korkortsportalen.se

 # Copyright (c) 1997- The Swedish Internet Foundation.
# All rights reserved.
# The information obtained through searches, or otherwise, is protected
# by the Swedish Copyright Act (1960:729) and international conventions.
# It is also subject to database protection according to the Swedish
# Copyright Act.
# Any use of this material to target advertising or
# similar activities is forbidden and will be prosecuted.
# If any of the information below is transferred to a third
# party, it must be done in its entirety. This server must
# not be used as a backend for a search engine.
# Result of search for registered domain names under
# the .se top level domain.
# This whois printout is printed with UTF-8 encoding.
#
state: active
domain: korkortsportalen.se
holder: domtra1140-00001
admin-c: CSCDOIN1908-6630
tech-c: CSCDOIN1908-6053
billing-c: -
created: 2006-04-18
modified: 2019-09-10
expires: 2021-04-18
transferred: 2019-05-23
nserver: dns1.cscdns.net
nserver: dns2.cscdns.net
dnssec: unsigned delegation
registry-lock: unlocked
status: ok
registrar: CSC Corp Domains

Websites with Similar Names

Korko.club
KORKO Fußballmanagement
Korkof88.xyz
503 Service Temporarily Unavailable
Korkom.in
Account Suspended
Korkom.info
Срок регистрации домена korkom.info истёк
Korkom.online
Срок регистрации домена korkom.online истёк
Korkom.shop
korkom.shop -&nbspkorkom Resources and Information.
Korkom23.com
Срок регистрации домена korkom23.com истёк
Korkom23.online
Срок регистрации домена korkom23.online истёк

Recently Updated Websites

Facces.info (2 seconds ago.)Kdao.com (3 seconds ago.)Dingfengqkw.com (7 seconds ago.)Thestpetersburgdentist.com (8 seconds ago.)Lollypopsonline.com (8 seconds ago.)Beyoutifulestheticspmu.com (10 seconds ago.)Pvc.com (10 seconds ago.)Turska-serija.com (14 seconds ago.)Vinitunin.com (15 seconds ago.)Tiyuvip197.vip (16 seconds ago.)Talking-book-store.com (16 seconds ago.)Customerstrusted.com (18 seconds ago.)Proreko.de (24 seconds ago.)Azur365.com (26 seconds ago.)Vhparfum.com (27 seconds ago.)Skysmoke.de (29 seconds ago.)Benkumata.com (30 seconds ago.)Qzav.cc (30 seconds ago.)Personnel.com.ua (31 seconds ago.)Nder.de (34 seconds ago.)Pagidracing.shop (34 seconds ago.)Booti.org (39 seconds ago.)Mycrutch.com (40 seconds ago.)Cadeiragamer.net (41 seconds ago.)Dediserverhosting.com (41 seconds ago.)Birmingham-removals.com (50 seconds ago.)Retailgates.com (51 seconds ago.)Asalposting.com (51 seconds ago.)Flexeventos.com.br (51 seconds ago.)Linguacenter-internacional.com (52 seconds ago.)

Recently Searched Keywords

mnh rt (1 second ago.)php (1 second ago.)pillfollowerwidthorigwidth (1 second ago.)more work samples (1 second ago.)heard (4 seconds ago.)rca to hdmi cable (4 seconds ago.)newsa (5 seconds ago.)ging vin v (7 seconds ago.)video center (8 seconds ago.)activités (9 seconds ago.)var htmldiv documentgetelementbyidrs-plugin-settings-inline-css (10 seconds ago.)old html uploader (11 seconds ago.)novel project (12 seconds ago.)pozwala na (13 seconds ago.)positionabsolutetop0right0bottom0left0border-radius0 (13 seconds ago.)turanza (14 seconds ago.)chuyển+phát+nhanh (14 seconds ago.)koupit (14 seconds ago.)niskopodwozie naczepa wynajem lawety transport ciągników siodłowych (15 seconds ago.)first time home buyers (17 seconds ago.)drag (21 seconds ago.)nbsp3 february (22 seconds ago.)carrousel (22 seconds ago.)still-arser (23 seconds ago.)cara lapor (24 seconds ago.)row3 (25 seconds ago.)bahwan group (26 seconds ago.)voir la vidéo (29 seconds ago.)slo (29 seconds ago.)爆乳 [新垣诗音] (30 seconds ago.)