Korzár SME | Správy z východného Slovenska

Safety: Low trust score
Year Founded: 2020
Global Traffic Rank: Unknown
Estimated Worth: $9
Category: This site has not been categorized yet

Všetko dôležité z východného Slovenska na jednom mieste.



Domain summary

Last updated
2020-10-19
Domain label
korzar
Domain extension
sk
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is korzar.sk ranked relative to other sites:

Percentage of visits to korzar.sk from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Korzar.sk registered?
A: Korzar.sk was registered 5 months, 4 weeks, 1 day, 13 hours, 51 minutes, 9 seconds ago on Monday, October 19, 2020.
Q: When was the WHOIS for Korzar.sk last updated?
A: The WHOIS entry was last updated 5 months, 4 weeks, 1 day, 13 hours, 51 minutes, 9 seconds ago on Monday, October 19, 2020.
Q: What are Korzar.sk's nameservers?
A: DNS for Korzar.sk is provided by the following nameservers:
  • nss1.bonet.sk
  • nss1.bntb.net
  • nss2.bonet.sk
Q: Who is the registrar for the Korzar.sk domain?
A: The domain has been registered at .
Q: What is the traffic rank for Korzar.sk?
A: Korzar.sk has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Korzar.sk each day?
A: Korzar.sk receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Korzar.sk resolve to?
A: Korzar.sk resolves to the IPv4 address 185.63.157.242.
Q: In what country are Korzar.sk servers located in?
A: Korzar.sk has servers located in the Slovakia.
Q: What webserver software does Korzar.sk use?
A: Korzar.sk is powered by webserver.
Q: Who hosts Korzar.sk?
A: Korzar.sk is hosted by Petit Press, a.s. in Slovakia.
Q: How much is Korzar.sk worth?
A: Korzar.sk has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Korzar.sk Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Korzar.sk Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Korzar.sk

H1 Headings

1 :
  1. Korzár

H2 Headings

51 :
  1. Východ má 367 nových nakazených, Slovensko 860
  2. V Smere ostali v prešovskom krajskom zastupiteľstve iba štyria poslanci
  3. Na cvičení pri Humennom sa nakazili vojaci, ale cvičilo sa ďalej
  4. Šéf epidemiológov v Bardejove: Koronavírus je v takmer každej obci
  5. Zrušenie mestských častí v Košiciach zrušili na prvom stretnutí
  6. Spor o hlásenia v prešovskej MHD: Bývalého riaditeľa nahradí ženský hlas
  7. Infektológ Jarčuška: Žiadne tliachaniny, máme reálne dáta
  8. V aute znásilnil manželku, v podmienke dostal desať rokov
  9. Stáročia o ňom nik nevedel. Zvyšky stredovekého kostola ukrýva les
  10. Z Antarktídy do civilizácie. Predstava návratu bola pre filmárov desivá
  11. Kica: Dávame prednosť cudzím a svojich si nevážime
  12. Varíme s Korzárom bez mäsa: Špagety z tekvice, plnený patizón, cuketové karí
  13. Polícia riešila podozrivý tréning v zamknutej aréne. Narátali trikrát viac detí
  14. Norné steny neodolali povodni, po Ružíne opäť plávajú tony odpadu
  15. Mesto Košice ide kupovať plaváreň. Čaká ju megainvestícia
  16. Ďalších dvanásť pozitívnych prípadov. V tíme Popradu je koronavírus
  17. Hubár zahynul v Slovenskom raji po páde v strmom teréne
  18. Športový víkend na východe - servis výsledkov a faktov
  19. Košická pionierka je posledná. Má 65 rokov a stále jej to šliape
  20. Profesionálna nemocničná klaunka: Najťažšie je vidieť utrpenie a spracovať ho
  21. Grand Prix si z Popradu odnáša Pavol Barabáš
  22. Hráčka Košíc o testovaní: Paličku som cítila až v mozgu
  23. Mestský úrad v Spišskej Novej Vsi prechádza na krízový režim
  24. Košickému mestskému zastupiteľstvu bude predchádzať testovanie
  25. Na východe pribudlo 484 pozitívne testovaných, na Slovensku 1 567
  26. Polícia obvinila z drogovej trestnej činnosti štyri osoby
  27. Cestický starosta dostal za napadnutie podriadenej podmienku. Odmietol ju
  28. Stakčínčan kúpil ojazdené auto. Nepojazdné stojí na dvore
  29. Šoféroval bez vodičáku a spôsobil nehodu. Nafúkal cez tri promile
  30. V košickej MHD chystajú virtuálny lístok
  31. KSK spracoval plán udržateľnej mobility, prognózuje stav do roku 2050
  32. Herec Josef Trojan: Bylinky som sa učil naspamäť, spájalo ma to s postavou
  33. Herečka Zdenka Kvasková nekváskuje a nepečie, necháva to na priateľa
  34. Dvanásť palíc za opicu. S epidémiou sa nežartovalo
  35. Vodičák, techničák, zmätky: Načo to bolo dobré
  36. Kam sa hrabú vojaci na štátnych úradníkov
  37. Verím, že v Košiciach bude hrať aj reprezentácia, vraví Ivan Kozák
  38. Debut hádzanárov Prešova v Európskej lige bude v riadnom termíne
  39. V Prešove ešte nevedia, či s francúzskym Nimes budú hrať
  40. Lyceálna knižnica v Kežmarku ukrýva Nostradama aj recept na večný život
  41. Košice pred sto rokmi: Pekárski pomocníci štrajkovali, polícia odhalila tajnú organizáciu
  42. Vo Vyšnej Myšli sa zachovalo močidlo. Je z neho oddychový areál
  43. Historická železnička prežila turbulentnú sezónu, ďalšia bude bez Katky
  44. Mama učí deti doma: Chuť spoznávať ubíja zapnutá televízia alebo tablet
  45. Horský záchranár: Matovič v teniskách na Slavkovskom štíte nie je dobrý príklad
  46. Spišské divadlo presúva svoje aktivity do online priestoru
  47. Divadlo Alexandra Duchnoviča uvedie komédiu Aj múdry schybí
  48. Akademický Prešov ponúkne online prenosy jednotlivých vystúpení
  49. Politici hľadajú spôsoby, ako spacifikovať novinárov
  50. Rok po vražde: Toto je obraz, akou sme krajinou
  51. Notár asistoval Kočnerovi pri tunelovaní. Trestu sa môže vyhnúť

H3 Headings

18 :
  1. Predpoveď počasia na dnes
  2. Naposledy aktualizované o 12:14
  3. Predpoveď počasia na:
  4. Koronavírus na Slovensku
  5. Počasie
  6. Najčítanejšie na Korzár
  7. Inzercia - Tlačové správy
  8. Blogy SME
  9. Spravodajstvo
  10. Krimi
  11. Dopravný servis
  12. Šoubiznis
  13. Komentáre
  14. Šport
  15. Zaujímavosti
  16. Ľudia
  17. Kultúra
  18. Odporúčame zo Sme.sk

H4 Headings

5 :
  1. Bratislava
  2. - vyberte -
  3. Západ
  4. Stred
  5. Východ

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

107 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal (nofollow)

0:

Links - Outbound

416:

Links - Outbound (nofollow)

0:

Keyword Cloud for Korzar.sk

typeofnakazenchrieila podozriv trningbreak casemanelku voptions trackoptions noninteraction13pageop plvaj tonyneodolali povodni popodozriv trningsmphrtrackurliadne tliachaniny mme0 optionstrningif typeof stormexternaldatasmeadmanagermngrdisplayinrssleepakdesamegainvestciabudeplvaj11smeskinfektolgmartindatagaeventcategory splittestaj9case6trning vskryvypnfunction stormcollectordatalayerpushscope pagestrmom ternesteny neodolalioptionstakmer kadej obciinittrackpush elem datagaeventcategorytypeof stormexternaldatam 367 novchtestovanch na slovensku8ustormexternaldatacje v2marcinovl lename varpozitvne testovanchelem datagaeventcategorynakazench slovensko16nasplittest datagaeventactionfunction stormcollectordatalayerpushscopeappendzruenie mestskchtypedesktopstrmomv podmienke dostalkey adblockertestovanchnartalihotrue varaute znsilnilnajtanejieifpositiondatagaeventcategory splittest datagaeventactionpovodni poelementgetattributenameundefinedmanelkukoiciachepidemiolgov vcheck ifstormcollectordatalayerpushscope pageviac det fotoslovensko 860dategettimenulldostal desa rokovtony odpadu fotopde vssmphridv strmom terneje v takmernoneraji povna prvomthlassmeadmanagercmdpushfunctiondet fotostormexternaldata undefinedpolciainittrackpushzov slovenskom rajielemtrackoptionskupova plavre akviac detfoto spravodajstvovchodezdatagaeventcategory367 novch nakazenchdaniela marcinovsteny0 options trackoptionspo pdetipyskryvypn reklamu smeadmanagercmdpushfunctionallf epidemiolgovsplittestcookietrikrtreklamu smeadmanagercmdpushfunctionpovodni po runeneodolali povodninew dategettimena slovensku 1tliachaniny mme relnenoninteraction trueeteop plvajsmeadmanagercmdpushfunction smeadmanagermngrdisplaygtgslugsmphractivev koiciachmhdastxfoto udia1v zamknutej arneelem datagaeventcategory splittestbezz kocpredreklamu smeadmanagercmdpushfunction smeadmanagermngrdisplayinrswev koiciach zruilireginuznsilnil manelkupo rune opm 367inittrackzo spiapo pde vstormcollectordatalayerpushscope page keysmevchod mspia1 varniealierizikooptions trackoptionspodmienke dostalexpireszruili na prvomzahynul v slovenskomznsilnil manelku vonlinenbspnbspnbspdotliachaninyprvomsmphridlist smphridlistsacheckkupova plavrelarne nartalipodozriv trning vreturndetskryvypn reklamuide kupova plavreneodolalistormexternaldata undefined stormexternaldatacollectorsenddataadblockdetectorkoickejkey adblocker valuepreopvideoplavrev auteprvom stretnutpona vchode pribudloplvaj tony odpadurefast vnamena prvom stretnutraji po pdeide kupovatrning v zamknutejkadej obcialebodatagaeventactionkadejpreovtype parenttony odpadureklamumme relne dtavar4trikrt viac detreturn falseyportelsetliachaniny mmejupdebreakideepidemiolgovz reginu arinovchobcikoiciach zruilinorn steny neodolalinorn stenyenabledslovenskomkeyokoliaversionkoronavrusgiveatryjndobrekoickpodmienke dostal desapodozrivurldostal desabardejovedocumentaddeventlistenerdomcontentloaded functionmesto koice ideepidemiolgov v bardejoveplvaj tonyznsilnilv podmienkeinithubr zahynul vnull ifpage keydatasmphrobjecttypeof stormexternaldata undefinedmestskch astf epidemiolgov vdtakoc a okoliavaluepozitvne testovanch nakoice ide7nie jemmeast v koiciachplavre akvchodreturn truezruenie mestskch astkorzracontinuepozitvnev slovenskomsprvyak ju megainvestciaarne nartali trikrtjaruka iadnekupovadatamzamknutej arne nartaliposmanelku v podmienketrikrt viactestovanch nazahynul vmestskch ast vinittrackpush elemplavre ak juscope page keykorzrcampaignraji14stormcollectordatalayerpushscopesmphridlistnakazench slovensko 860bardejove koronavrusnoninteractionslovensku 15danielapetermesto koicescope pageudiaviacitselfwhilepage key adblockernovzruili navchod m 367v aute znsilniljenornkoronavrus je vscopepribudlo 484kocsteny neodolali povodnisprvy zv takmer kadejnovch nakazench slovenskozaobjidcookietrackoptions noninteractiontakmergateoffsetslovenskopo runeodpadu fotoakostretnuttruena vchodejarukadnesvetkyaricezzruenierune op plvajslovenskom raji0zapnutif typeofkoice ide kupovanewpagetypehostnameisresponsivebolhasattributescanedparentelemautevyberterieila podozrivsmeadmanagercmdpushfunction smeadmanagermngrdisplayinrsundefined stormexternaldatacollectorsenddataadblockdetectorrune opdocumentcookiesplitreginu aridetipristormcollectordatalayerpush scope pagetietopolcia rieila podozrivpribudlo 484 pozitvnekoiciach zruili nadomaininfektolg jaruka iadne12stormcollectordatalayerpush scopedostalzaujmavosti10relne dtausertrackoptions noninteraction truemestskchslovenskom raji pov takmeriadnesplittestcookie nullsectionidterneaute znsilnil manelkupodmienkefalserunebardejove koronavrus jefunctionadblockerhubrv zamknutejeventinfektolg jarukaodpadusiktorsleep 0koicerelne dta 42desa rokovspravodajstvo z kocna korzrtonyzruiliv bardejove koronavrus15xxxdta 42367 novchparentslovenskumestodatesleep 0 options484 pozitvnepde v strmomv bardejoveservisarneju megainvestciavchode pribudlo 484nartali trikrt viacrieilasplittestall data484 pozitvne testovanchrelnestormexternaldatacollectorsenddataadblockdetectorspravodajstvo zofhubr zahynulstormcollectordatalayerpushdocumentaddeventlistenerdomcontentloadedak juzamknutej arnesmeadmanagermngrdisplaygtgzamknutejrokovtakmer kadej0 returnv strmomz reginuzahynulvojaciukrvaadblocker valuemme relne3spravodajstvopribudloiadne tliachaninyplnvchode pribudlojaruka iadne tliachaninyna slovenskuomfotonartali trikrtnovch nakazenchkoronavrus jepolcia rieilapovodnisplittestcookieraw

Longtail Keyword Density for Korzar.sk

KeywordsOccurences
stormcollectordatalayerpushscope page key12
koc a okolia7
scope page key7
stormcollectordatalayerpush scope page7
zamknutej arne nartali5
v zamknutej arne5
jaruka iadne tliachaniny5
iadne tliachaniny mme5
tliachaniny mme relne5
mme relne dta5
polcia rieila podozriv5
rieila podozriv trning5
podozriv trning v5
trning v zamknutej5
trikrt viac det5
arne nartali trikrt5
nartali trikrt viac5
skryvypn reklamu smeadmanagercmdpushfunction5
reklamu smeadmanagercmdpushfunction smeadmanagermngrdisplayinrs5
infektolg jaruka iadne5
plvaj tony odpadu4
norn steny neodolali4
steny neodolali povodni4
neodolali povodni po4
povodni po rune4
po rune op4
rune op plvaj4
op plvaj tony4
spravodajstvo z koc4
viac det foto4
slovenskom raji po3
vchode pribudlo 4843
typeof stormexternaldata undefined3
if typeof stormexternaldata3
key ad-blocker value3
page key ad-blocker3
function stormcollectordatalayerpushscope page3
na slovensku 13
testovanch na slovensku3
pozitvne testovanch na3
484 pozitvne testovanch3
mesto koice ide3
pribudlo 484 pozitvne3
relne dta 423
na vchode pribudlo3
raji po pde3
tony odpadu foto3
koice ide kupova3
ide kupova plavre3
kupova plavre ak3
plavre ak ju3
ak ju megainvestcia3
hubr zahynul v3
zahynul v slovenskom3
v strmom terne3
pde v strmom3
po pde v3
v slovenskom raji3
inittrackpush elem data-ga-event-category3
elem data-ga-event-category splittest3
367 novch nakazench3
v bardejove koronavrus3
epidemiolgov v bardejove3
f epidemiolgov v3
z reginu ari3
nakazench slovensko 8603
novch nakazench slovensko3
m 367 novch3
koronavrus je v3
vchod m 3673
trackoptions noninteraction true3
options trackoptions noninteraction3
0 options trackoptions3
sleep 0 options3
data-ga-event-category splittest data-ga-event-action3
bardejove koronavrus je3
je v takmer3
dostal desa rokov3
na prvom stretnut3
podmienke dostal desa3
v podmienke dostal3
manelku v podmienke3
znsilnil manelku v3
aute znsilnil manelku3
v aute znsilnil3
zruili na prvom3
v takmer kadej3
koiciach zruili na3
v koiciach zruili3
ast v koiciach3
mestskch ast v3
zruenie mestskch ast3
takmer kadej obci3
stormexternaldata undefined stormexternaldatacollectorsenddataadblockdetector3
break case27
page key20
stormcollectordatalayerpushscope page13
if typeof11
smeadmanagercmdpushfunction smeadmanagermngrdisplayinrs9
reklamu smeadmanagercmdpushfunction7
scope page7
stormcollectordatalayerpush scope7
z koc7
spravodajstvo z6
return false6
skryvypn reklamu5
polcia rieila5
infektolg jaruka5
jaruka iadne5
iadne tliachaniny5
tliachaniny mme5
mme relne5
relne dta5
rieila podozriv5
viac det5
podozriv trning5
v zamknutej5
zamknutej arne5
l l5
nartali trikrt5
trikrt viac5
arne nartali5
trning v5
na slovensku5
z reginu5
op plvaj4
povodni po4
det foto4
na vchode4
norn steny4
type parent4
steny neodolali4
splittestcookie null4
v koiciach4
neodolali povodni4
null if4
rune op4
v bardejove4
plvaj tony4
tony odpadu4
po rune4
je v4
strmom terne3
odpadu foto3
hubr zahynul3
zahynul v3
po pde3
v strmom3
pde v3
raji po3
slovenskom raji3
v slovenskom3
vchode pribudlo3
dta 423
testovanch na3
pribudlo 4843
smphridlist smphridlist3
undefined stormexternaldatacollectorsenddataadblockdetector3
stormexternaldata undefined3
typeof stormexternaldata3
ad-blocker value3
key ad-blocker3
documentaddeventlistenerdomcontentloaded function3
function stormcollectordatalayerpushscope3
1 var3
inittrackpush elem3
elem data-ga-event-category3
all data3
484 pozitvne3
check if3
return true3
data-ga-event-category splittest3
splittest data-ga-event-action3
new dategettime3
sleep 03
0 options3
nie je3
slovensku 13
ak ju3
pozitvne testovanch3
ju megainvestcia3
f epidemiolgov3
plavre ak3
zruili na3
367 novch3
novch nakazench3
nakazench slovensko3
slovensko 8603
daniela marcinov3
foto spravodajstvo3
prvom stretnut3
na prvom3
koiciach zruili3
v aute3
ast v3
mestskch ast3
zruenie mestskch3
reginu ari3
kadej obci3
takmer kadej3
v takmer3
koronavrus je3
bardejove koronavrus3
m 3673
aute znsilnil3
kupova plavre3
sprvy z3
ide kupova3
koice ide3
mesto koice3
epidemiolgov v3
zo spia3
options trackoptions3
trackoptions noninteraction3
noninteraction true3
true var3
0 return3
znsilnil manelku3
smeadmanagercmdpushfunction smeadmanagermngrdisplaygtg3
vchod m3
na korzr3
foto udia3
desa rokov3
dostal desa3
podmienke dostal3
v podmienke3
manelku v3
name var3
var69
v67
if53
na47
pagetype32
case32
foto32
function31
break29
z28
sa28
o22
page22
key21
021
value20
return19
je19
true17
stormcollectordatalayerpushscope15
s14
false13
po13
l13
new12
smeadmanagercmdpushfunction12
typeof12
112
ako11
null11
aj11
undefined11
spravodajstvo11
u9
smeadmanagermngrdisplayinrs9
slovensku8
splittestcookie8
do8
name8
koc8
polcia8
pre7
user7
novch7
mme7
27
37
pri7
smphridlist7
parent7
type7
okolia7
stormcollectordatalayerpush7
data7
47
reklamu7
bude7
e7
scope7
viac6
hostname6
slovensko6
check6
koronavrus6
za6
korzr6
nov6
reginu6
m6
koice6
iadne5
rieila5
jaruka5
infektolg5
smphractive5
we5
koiciach5
55
tliachaniny5
relne5
65
skryvypn5
podozriv5
dta5
zo5
det5
trikrt5
nartali5
arne5
smesk5
zamknutej5
martin5
trning5
version5
else5
udia5
75
si5
smphrid5
marcinov5
event5
f5
85
slug5
url5
povodni4
dnes4
xxx4
documentaddeventlistenerdomcontentloaded4
x4
init4
domain4
options4
norn4
steny4
neodolali4
rune4
splittestcookieraw4
op4
plvaj4
tony4
smphrtrackurl4
odpadu4
ide4
pozitvne4
cez4
ju4
tieto4
vchode4
while4
vyberte4
t4
jn4
dostal4
itself4
data-smphr-object4
all4
bardejove4
mhd4
alie4
ari4
peter4
94
append4
nakazench4
pos4
objid4
rokov4
giveatry4
preov4
vchod4
alebo4
om4
testovanch4
103
stormexternaldatacollectorsenddataadblockdetector3
hasattributescanedparentelem3
pribudlo3
ref3
113
continue3
ete3
koickej3
dategettime3
stormexternaldata3
nie3
pln3
ad-blocker3
dobre3
cookie3
y3
position3
none3
123
pred3
sme3
elementgetattributename3
isresponsive3
133
ukrva3
najtanejie3
143
zapnut3
riziko3
sprvy3
vetky3
smeadmanagermngrdisplaygtg3
153
daniela3
163
hlas3
vojaci3
epidemiolgov3
takmer3
kadej3
obci3
gateoffset3
c3
mestskch3
data-ga-event-category3
desktop3
documentcookiesplit3
sectionid3
inittrack3
inittrackpush3
elem3
splittest3
expires3
data-ga-event-action3
sleep3
trackoptions3
noninteraction3
enabled3
date3
zruenie3
ast3
deti3
pde3
ak3
megainvestcia3
hubr3
zahynul3
slovenskom3
raji3
strmom3
kupova3
terne3
onlinenbspnbspnbsp3
koick3
video3
korzra3
ktor3
plavre3
mesto3
zruili3
podmienke3
prvom3
stretnut3
servis3
aute3
znsilnil3
manelku3
desa3
spia3
ho3
zaujmavosti3
bol3
port3
tipy3
bez3
campaign3

Who hosts Korzar.sk?

Korzar.sk Hosting Provider Information

Hosted IP Address:185.63.157.242
Hosted Hostname:185.63.157.242
Service Provider:Petit Press, a.s.
Hosted Country:SlovakiaSK
Location Latitude:48.6667
Location Longitude:19.5
Webserver Software:Not Applicable

Is "Petit Press, a.s." in the Top 10 Hosting Companies?

Name
Percentage
DoD Network Information Center
16.7387%
GoDaddy.com, LLC
8.5968%
Namecheap, Inc.
4.2653%
Confluence Networks Inc
2.7791%
Google Inc.
2.3954%
Merit Network Inc.
1.8799%
Fara Negar Pardaz Khuzestan
1.8361%
1&1 Internet AG
1.8274%
Amazon.com, Inc.
1.7814%
Cogent Communications
1.6096%
Petit Press, a.s.
0.0000%

HTTP Header Analysis for Korzar.sk

Http-Version: 1.1
Status-Code: 301
Status: 301 Moved Permanently
content-length: 0
location: https://korzar.sme.sk/

Korzar.sk Domain Nameserver Information

HostIP AddressCountry
nss1.bonet.sk 92.60.52.37Slovakia Slovakia
nss1.bntb.net 178.62.71.154Russia Russia
nss2.bonet.sk 92.60.52.38Slovakia Slovakia


Need to find out who hosts Korzar.sk?


Domain Registration (WhoIs) information for Korzar.sk

 Domain: korzar.sk
Registrant: PPRE-0001-4025
Admin Contact: PPRE-0001-4025
Tech Contact: PPRE-0001-4025
Registrar: WEBS-0001
Created: 2003-02-27
Updated: 2020-03-04
Valid Until: 2021-02-27
Nameserver: nss1.bonet.sk
Nameserver: nss2.bonet.sk
Nameserver: nss1.bntb.net
EPP Status: ok

Registrar: WEBS-0001
Name: WebSupport s.r.o.
Organization: Websupport, s.r.o.
Organization ID: 36421928
Phone: +421.220608080
Email: Login to show email
Karadžičova 12
City: Bratislava
Postal Code: 82108
Country Code: SK
Created: 2017-09-01
Updated: 2020-09-16

Contact: PPRE-0001-4025
Name: Miroslav POLNIS, Michal MOSCOVIC
Organization: Petit Press, a.s.
Organization ID: 35790253
Street: Lazaretska 12
City: Bratislava
Postal Code: 81108
Country Code: SK
Registrar: WEBS-0001
Created: 2017-09-01
Updated: 2019-10-30

Websites with Similar Names

Korzabasim.com
Korza Basım
Korzaki.com
korzaki.com - Registered at Namecheap.com
Korzal.com
korzal.com - Registered at Namecheap.com
Korzamods.com
korzamods.com -&nbspThis website is for sale! -&nbspkorzamods Resources and Information.
Korzang.com
korzang.com - current events blog
Korzar.com
Restaurace s výborným pivem a širokou nabídkou rumů | Restaurace Korzár
Korzar.sk
Korzár SME | Správy z východného Slovenska
Korzayavukatlik.com
Korzay & Korzay Avukatlık, Bandırma Hukuk - Korzay & Korzay Avukatlık BürosuKorzay & Korzay Avukatlık Bürosu

Recently Updated Websites

Thereshegoesblog.com (1 second ago.)California101radio.com (2 seconds ago.)Illinoisfacemask.com (2 seconds ago.)Sadupayog.com (2 seconds ago.)Compucamp2019.com (3 seconds ago.)Covidsolutionshawaii.com (3 seconds ago.)Tgisraipur.com (3 seconds ago.)Ubhabucks.com (4 seconds ago.)Bitmallhire.org (4 seconds ago.)Supperandco.com (4 seconds ago.)Medgas-usa.com (4 seconds ago.)Chrisezeani.com (4 seconds ago.)Omererkan.com (4 seconds ago.)Level27.be (4 seconds ago.)Royalnesher.com (5 seconds ago.)Ssuiteoffice.com (5 seconds ago.)Chinese-drywall-answers.com (5 seconds ago.)Moto-techno.com (5 seconds ago.)Clientsnow.com (6 seconds ago.)Straub-trumpets.com (6 seconds ago.)Nydigitalproducts.com (6 seconds ago.)Borctahsilat.xyz (6 seconds ago.)Fyls-fishing.com (6 seconds ago.)925-events.com (6 seconds ago.)Veritaserumnl.com (6 seconds ago.)Theories.com (6 seconds ago.)Bsumc.info (6 seconds ago.)Jymtrainingja.com (7 seconds ago.)Vdel.com (7 seconds ago.)Value-account.eu (8 seconds ago.)

Recently Searched Keywords

171 1 (7 seconds ago.)qatar airways holidays (10 seconds ago.)o szleri (11 seconds ago.)kriz melih gkek039ten (12 seconds ago.)325 pasta (13 seconds ago.)belediyelerinin (14 seconds ago.)pasta maliyetleri 8 (15 seconds ago.)galeri gece kulübü ‘erkeğe benziyorsun’ dedi ve içeri almadı (18 seconds ago.)ergün poyraz (19 seconds ago.)ankara039y (20 seconds ago.)bu nasıl vekil (31 seconds ago.)baronu yaam ayavefe (32 seconds ago.)du lịch mai châu – mộc châu – điện biên – lai châu – sapa 5 ngày 4 đêm5.690.000đ (32 seconds ago.)ankara039y parsel parsel (33 seconds ago.)hes kodu kontrol (34 seconds ago.)23 yaşındaki gamze evinde öldürüldü! (36 seconds ago.)https: www.bookfoto.com membres membres2 morgane804 263015 20180212-22[32-46][00-59]-0.jpg (36 seconds ago.)eletirdi (37 seconds ago.)yaptran ilk kii (38 seconds ago.)gkek039ten ok (39 seconds ago.)php projects for students free download (39 seconds ago.)gstererek (40 seconds ago.)bahn.de (40 seconds ago.)https: www.bookfoto.com membres membres2 morgane804 263015 20180212-22[32-46][00-59]-0.jpg (40 seconds ago.)https: www.bookfoto.com membres membres2 morgane804 263015 20180212-22[32-46][00-59]-0.jpg (41 seconds ago.)zdil osuruktan (42 seconds ago.)yurt gazetesi kimin (43 seconds ago.)szleri yediini ifade (44 seconds ago.)geçmiş acıların rehineleri (45 seconds ago.)lucas (46 seconds ago.)