Kramer Paardensport | Ruitersportartikelen & paardenartikelen

Safety: Low trust score
Year Founded: 2021
Global Traffic Rank: Unknown
Estimated Worth: $9
Category: This site has not been categorized yet

Meer dan 25.000 ruitersportartikelen en toebehoren van meer dan 100 merken ✓veel keuze ✓lage prijs ✓60 dagen geld-terug-garantie



Domain summary

Last updated
2021-03-23
Domain label
kramer
Domain extension
nl
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is kramer.nl ranked relative to other sites:

Percentage of visits to kramer.nl from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Kramer.nl registered?
A: Kramer.nl was registered 1 month, 3 weeks, 2 days, 21 hours, 4 minutes, 9 seconds ago on Tuesday, March 23, 2021.
Q: When was the WHOIS for Kramer.nl last updated?
A: The WHOIS entry was last updated 1 month, 3 weeks, 2 days, 21 hours, 4 minutes, 9 seconds ago on Tuesday, March 23, 2021.
Q: What are Kramer.nl's nameservers?
A: DNS for Kramer.nl is provided by the following nameservers:
  • ns4.pns.de
  • ns2.pns.de
  • ns1.pns.de
  • ns3.pns.de
Q: Who is the registrar for the Kramer.nl domain?
A: The domain has been registered at Stichting Internet Domeinregistratie NL.
Q: What is the traffic rank for Kramer.nl?
A: Kramer.nl has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Kramer.nl each day?
A: Kramer.nl receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Kramer.nl resolve to?
A: Kramer.nl resolves to the IPv4 address 185.38.118.176.
Q: In what country are Kramer.nl servers located in?
A: Kramer.nl has servers located in the Germany.
Q: What webserver software does Kramer.nl use?
A: Kramer.nl is powered by Apache webserver.
Q: Who hosts Kramer.nl?
A: Kramer.nl is hosted by WEBSALE AG in Germany.
Q: How much is Kramer.nl worth?
A: Kramer.nl has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Kramer.nl Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Kramer.nl Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Kramer.nl

H1 Headings

2 :
  1. Outfits
  2. KRAMER PAARDENSPORT - UW EXPERT IN PAARDENSPORTARTIKELEN

H2 Headings

0 :

H3 Headings

8 :
  1. Dames bovenkleding
  2. Dames rijbroeken
  3. Rijlaarzen & rijschoenen
  4. Paardendekens
  5. Paardenvoeding
  6. Caps
  7. Rijhandschoenen
  8. Westernrijden

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

165 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

109:

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Kramer.nl

first timeremovetokenmega storesonscadeaubonnen6breakpoint 768 settingsdefaultsession1 height4 slidestoscrollprevarrow arrowsthissessionaddedreturn dplnk iftypebeenmeervanafif localstorage throw12kramer paardensportslidestoscroll 1prevarrow arrows trueslidestoshowarrowshas beenmessagetimeless elegance mettimesshownextarrowteddyfleecemediadisplayedclientwidth13true ificon4 slidestoscroll 1eventlistenermodehistoryreplacestatebreakpoint 992if thisoptionsdetecthomescreenslidestoshow 3varathlanguagereturnnewscreenwidthspeed 300 slidestoshowtimelessstandaloneathosversiononlineresponsive breakpoint 992var dplnkoutfits nieuwuserwenotobject0meshload300 slidestoshowlocalstoragetrue992 settingsloadedruiterthrowfalse nextarrow prevarrowisvalidlocationtimeless elegancenslickslidermultiitemdplnk iftypeathhaslocalstorage falsebhler nbsp1settings slidestoshowaanfalse iftrue infinitehomescreensettings slidestoshow 2nieuwveiligeuronot displayingthisshownresizetrue thisupdatesession ifthisupdatesessionelegance metnbsp1van1felix bhlerslidestoshow 4 slidestoscrollelegance vanafnubody paddingtopnbsp2bodywindownavigatortypeofhasifnextarrow prevarrow arrowsinitialslideauto768 settingsthisoptionsmandatorybreakpointdefinedthisdologadd768 settings slidestoshowthissessiondisplaycountthissessionoptedoutheightshoppenelegance vanaf euroundefinednowtrue infinite truepaardprevarrowhashnull executedprivate modekramermegaandroidinstancedaneuro 1990eenresponsive breakpointtrywindowdocumenttitle4thisapplicationicongroup1falsetimeinkopentrue thisupdatesessionathintltry if localstoragehistoryreplacestate windowdocumenttitledisplaying callout becauseslidestoshow 2voornew errorlocalstoragedots falsedots false nextarrow7paddingtopinfiniteom1 height autovanaf eurosettings slidestoshow 3removeelementsfalse nextarrowathathiscompatiblethisoptionsdebugaddedwindowinnerheightfelixfunctionlastdisplaytimethisupdatesession ifbecauseiftypethisoptionsmessageheight autoelse ifnu shoppenathhastokendisplayingreturn dplnkopacity 1 heightchannelif thisoptionsmandatorynulldisplaying callout992 settings slidestoshowinfinite truenieuw felix bhlernot displaying calloutcallout becausestoresthissessionif thissessionaddedhomescreen notremovetoken ifexecuted300 slidestoshow 4thisoptionsloggingslickslideroutfitsmetbreakpoint 7689errorlocalstoragehomescreen not displayingslidestoshow 4het11arrows trueiosalreadythisimgeuro 2990wijdotscalloutfunction eathosprivatecutstartvisit5return ifmeer danfelix bhler nbsp1localstorage throwfirstthisdologadd to homescreenwindowveilig inkopenthrow new errorlocalstoragethrow newif localstoragethisviewportclassnameeathos iosarrows true infinitenextarrow prevarrow8not definedspeedtimeless elegance vanafworldoutfitsbreakpoint 992 settingstry ifyounieuw felix10slidestoscrollpxnbsp1 nieuwresponsive2localstorage throw newathhaslocalstorageelseathismobilesafarierrorlocalstorage is notpaardensportopacity 1onzedelayedshowdomreadyopacityshowndplnksettingstypethisoptionsdetecthomescreenthisoptionsmessage messagethisoptionsmodalspeed 300covidtext3bhleroptionselegance

Longtail Keyword Density for Kramer.nl

KeywordsOccurences
nieuw felix bhler20
thisdologadd to homescreen14
displaying callout because13
not displaying callout13
homescreen not displaying13
timeless elegance vanaf5
elegance vanaf euro5
settings slidestoshow 24
opacity 1 height4
1 height auto4
felix bhler nbsp14
errorlocalstorage is not3
speed 300 slidestoshow3
768 settings slidestoshow3
breakpoint 768 settings3
settings slidestoshow 33
992 settings slidestoshow3
breakpoint 992 settings3
responsive breakpoint 9923
4 slidestoscroll 13
slidestoshow 4 slidestoscroll3
300 slidestoshow 43
arrows true infinite3
true infinite true3
throw new errorlocalstorage3
prevarrow arrows true3
nextarrow prevarrow arrows3
false nextarrow prevarrow3
dots false nextarrow3
timeless elegance met3
true thisupdatesession if3
try if localstorage3
if localstorage throw3
localstorage throw new3
return dplnk iftype3
felix bhler24
nieuw felix20
displaying callout14
homescreen not13
not displaying13
callout because13
vanaf euro12
return if10
timeless elegance10
nu shoppen8
settings slidestoshow7
else if6
historyreplacestate windowdocumenttitle6
euro 29905
elegance vanaf5
speed 3004
height auto4
1 height4
opacity 14
true thisupdatesession4
dots false4
thisupdatesession if4
infinite true4
arrows true4
nextarrow prevarrow4
true if4
slidestoscroll 14
var dplnk4
slidestoshow 24
kramer paardensport4
if localstorage4
meer dan4
false if4
nbsp1 nieuw4
private mode4
bhler nbsp14
return dplnk4
992 settings3
breakpoint 9923
responsive breakpoint3
slidestoshow 33
slidestoshow 43
300 slidestoshow3
true infinite3
breakpoint 7683
prevarrow arrows3
false nextarrow3
dplnk iftype3
outfits nieuw3
768 settings3
mega stores3
4 slidestoscroll3
throw new3
euro 19903
athhaslocalstorage false3
not defined3
localstorage throw3
if thisoptionsmandatory3
athos ios3
removetoken if3
try if3
has been3
null executed3
elegance met3
if thissessionadded3
first time3
if thisoptionsdetecthomescreen3
veilig inkopen3
function e3
thisoptionsmessage message3
new errorlocalstorage3
body padding-top3
if69
var49
false47
euro38
nieuw34
true33
function31
return24
bhler24
felix24
message23
022
homescreen20
not20
117
thisdologadd14
displaying14
callout14
vanaf13
because13
met12
athos11
slidestoshow11
elegance10
shoppen10
nbsp110
timeless10
nu9
else9
dplnk8
thisupdatesession8
28
paardensport7
athhaslocalstorage7
settings7
breakpoint7
e7
thissession7
37
thisoptionsmessage7
ath7
type7
shown6
kramer6
meer6
thisoptionsmandatory6
resize6
thisoptionsdetecthomescreen6
windowdocumenttitle6
historyreplacestate6
cutstart6
new6
thisoptionsdebug5
instance5
media5
thissessionadded5
ons5
voor5
mode5
px5
screenwidth5
45
show5
athosversion5
time5
athlanguage5
null5
has5
ios5
athiscompatible4
added4
removeelements4
localstorage4
infinite4
auto4
height4
opacity4
slidestoscroll4
54
speed4
prevarrow4
typeof4
nextarrow4
arrows4
dots4
thisapplicationicon4
thisshown4
64
thisoptionsmodal4
try4
initialslide4
private4
you4
window4
dan4
athintl4
mesh4
paard4
veilig4
iftype4
74
domready4
first4
van4
body4
executed4
nbsp24
user4
thisviewportclassname3
windowinnerheight3
thisimg3
group13
83
clientwidth3
teddyfleece3
n3
thissessiondisplaycount3
ath-3
stores3
93
slickslidermultiitem3
slickslideroutfits3
103
113
123
133
responsive3
padding-top3
world3
channel3
object3
ruiter3
outfits3
cadeaubonnen3
mega3
covidtext3
now3
wij3
onze3
standalone3
throw3
android3
displayed3
we3
lastdisplaytime3
defaultsession3
visit3
defined3
athismobilesafari3
load3
times3
windownavigator3
hash3
been3
errorlocalstorage3
thisoptionslogging3
delayedshow3
het3
om3
aan3
already3
thissessionoptedout3
isvalidlocation3
een3
inkopen3
options3
online3
removetoken3
athhastoken3
eventlistener3
loaded3
undefined3
icon3

Who hosts Kramer.nl?

Kramer.nl Hosting Provider Information

Hosted IP Address:185.38.118.176
Hosted Hostname:www.kramer.nl
Service Provider:WEBSALE AG
Hosted Country:GermanyDE
Location Latitude:51.2993
Location Longitude:9.491
Webserver Software:Apache

Is "WEBSALE AG" in the Top 10 Hosting Companies?

Name
Percentage
DoD Network Information Center
15.7948%
GoDaddy.com, LLC
8.0700%
Namecheap, Inc.
4.0119%
Confluence Networks Inc
2.6770%
Fara Negar Pardaz Khuzestan
2.1305%
Google Inc.
2.1184%
Merit Network Inc.
1.8272%
1&1 Internet AG
1.8076%
Cogent Communications
1.7178%
CloudFlare, Inc.
1.6296%
WEBSALE AG
0.0003%

HTTP Header Analysis for Kramer.nl

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Tue, 23 Mar 2021 05:53:14 GMT
Server: Apache
Strict-Transport-Security: max-age=31536000
Vary: Accept-Encoding
Content-Encoding: gzip
Pragma: no-cache
Cache-Control: no-cache
Content-Length: 34768
Content-Type: text/html; charset=iso-8859-1
Access-Control-Allow-Origin: https://cp.kraemer.de

Kramer.nl Domain Nameserver Information

HostIP AddressCountry
ns4.pns.de 74.208.254.4
ns2.pns.de 217.160.113.37
ns1.pns.de 62.116.159.4
ns3.pns.de 89.146.248.4


Need to find out who hosts Kramer.nl?


Domain Registration (WhoIs) information for Kramer.nl

 Domain name: kramer.nl
Status: active

Registrar:
Key-Systems GmbH
Im Oberen Werk 1
66386 St. Ingbert
Germany

Abuse Contact:

Creation Date: 1997-05-06

Updated Date: 2020-07-02

DNSSEC: no

Domain nameservers:
ns3.pns.de
ns4.pns.de
ns2.pns.de
ns1.pns.de

Record maintained by: NL Domain Registry

As the registrant's address is not in the Netherlands, the registrant is
obliged by the General Terms and Conditions for .nl Registrants to use
SIDN's registered office address as a domicile address. More information
on the use of a domicile address may be found at
https://www.sidn.nl/downloads/procedures/Domicile_address.pdf

Copyright notice
No part of this publication may be reproduced, published, stored in a
retrieval system, or transmitted, in any form or by any means,
electronic, mechanical, recording, or otherwise, without prior
permission of the Foundation for Internet Domain Registration in the
Netherlands (SIDN).
These restrictions apply equally to registrars, except in that
reproductions and publications are permitted insofar as they are
reasonable, necessary and solely in the context of the registration
activities referred to in the General Terms and Conditions for .nl
Registrars.
Any use of this material for advertising, targeting commercial offers or
similar activities is explicitly forbidden and liable to result in legal
action. Anyone who is aware or suspects that such activities are taking
place is asked to inform the Foundation for Internet Domain Registration
in the Netherlands.
(c) The Foundation for Internet Domain Registration in the Netherlands
(SIDN) Dutch Copyright Act, protection of authors' rights (Section 10,
subsection 1, clause 1).

Websites with Similar Names

Krame.site
Registrant WHOIS contact information verification | Namecheap.com
Krame.tech
krame.tech - Registered at Namecheap.com
Kramecek.cz
Doména je zaregistrována
Kramecenter.org
The Krame Center - The Krame Center for Mindful Living
Kramecenterformindfulliving.com
The Krame Center - The Krame Center for Mindful Living
Kramedia.com
Kramedia | C-Scape: Navigating the Rapidly Changing Worlds of Media and Business
Krameducation.com.au
Whiteboards, Wall Carpet, Quietspace, Brisbane, Melbourne, Sydney, Perth, Pinboards, Pinwall Wall Lining, Display Boards, Big Books, Australia
Krameki.org
krameki.org – このドメインはお名前.comで取得されています。

Recently Updated Websites

Baran.cafe (2 seconds ago.)Remotesads.com (3 seconds ago.)Acats.com (3 seconds ago.)Iamroolis.com (4 seconds ago.)Superstarstarts.com (6 seconds ago.)Ganwo.net (8 seconds ago.)Yclass.us (8 seconds ago.)Agservice-mi.com (8 seconds ago.)Wobushipanshen.com (9 seconds ago.)Exragazze.it (9 seconds ago.)Trimarofca.com (10 seconds ago.)37337.org (11 seconds ago.)Customironwelder.com (11 seconds ago.)Autowisebody.net (11 seconds ago.)Sunrise-vista.com (12 seconds ago.)Batmanonthebeatz.com (12 seconds ago.)Caieye.com (12 seconds ago.)Pensionhatzis.com (12 seconds ago.)Algo-pharma.info (13 seconds ago.)Artisan-charpentier-lyon.com (14 seconds ago.)Intelmicrosoftazurebootcamp.com (14 seconds ago.)Gotoinner.space (14 seconds ago.)Homecare.services (14 seconds ago.)Admprofessionals.com (15 seconds ago.)Gurudwar.com (15 seconds ago.)Janellesafford.com (15 seconds ago.)Maga-masks.us (15 seconds ago.)Saleportal.com (15 seconds ago.)Renecaissetea-canada.com (15 seconds ago.)Magnoliahilt.com (15 seconds ago.)

Recently Searched Keywords

admin skansa (2 seconds ago.)активация сим-карты (3 seconds ago.)viewing on a mobile device  (6 seconds ago.)interpreting localization (7 seconds ago.)欧美一级毛片免费高清_特级aav毛片欧美免费观看_一级毛片免费网站视频 (8 seconds ago.)months website security (11 seconds ago.)macau (0) (13 seconds ago.)10px 12px 0px (14 seconds ago.)bị tố “lừa đảo” – bạn có thật sự hiểu về mô hình nghỉ dưỡng mới đến từ resorts international việt nam (17 seconds ago.)aloe 8211 aloe (18 seconds ago.)6. sınıf matematik ders kitabı (19 seconds ago.)civitavecchia rome (19 seconds ago.)risultati referendum 2020 (20 seconds ago.)jeux les plus gagnants (22 seconds ago.)discover the lawn (25 seconds ago.)наум коржавин (26 seconds ago.)2016 extra dry (29 seconds ago.)grettacole copley (32 seconds ago.)福佳酒店 (36 seconds ago.)audubon audubon products (36 seconds ago.)coupe-hair (39 seconds ago.)no-repeat visibilityvisible (39 seconds ago.)pacific healthcare nursing home @ bukit merah (41 seconds ago.)price if available (41 seconds ago.) special (41 seconds ago.)колпачки на петли: типы (42 seconds ago.)osty meditech (46 seconds ago.)same-day repairs (49 seconds ago.)household equipment (50 seconds ago.)padi wreck diver course (54 seconds ago.)