Landkreis Böblingen -Start

Safety: Low trust score
Year Founded: 2021
Global Traffic Rank: Unknown
Estimated Worth: $9
Category: This site has not been categorized yet

Kreis-bb.de is a subdomain of De

Dies ist der Internetauftritt des Landkreises Böblingen



Domain summary

Last updated
2021-06-28
Domain label
kreis-bb
Domain extension
de
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Frequently Asked Questions (FAQ)

Q: When was Kreis-bb.de registered?
A: Kreis-bb.de was registered 5 months, 1 day, 23 hours, 26 minutes, 28 seconds ago on Monday, June 28, 2021.
Q: When was the WHOIS for Kreis-bb.de last updated?
A: The WHOIS entry was last updated 7 months, 1 week, 2 days, 23 hours, 26 minutes, 28 seconds ago on Tuesday, April 20, 2021.
Q: What are Kreis-bb.de's nameservers?
A: DNS for Kreis-bb.de is provided by the following nameservers:
  • ns59.domaincontrol.com
  • ns60.domaincontrol.com
Q: Who is the registrar for the Kreis-bb.de domain?
A: The domain has been registered at DENIC eG.
Q: What is the traffic rank for Kreis-bb.de?
A: Kreis-bb.de has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Kreis-bb.de each day?
A: Kreis-bb.de receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Kreis-bb.de resolve to?
A: Kreis-bb.de resolves to the IPv4 address .
Q: In what country are Kreis-bb.de servers located in?
A: Kreis-bb.de has servers located in the .
Q: What webserver software does Kreis-bb.de use?
A: Kreis-bb.de is powered by Apache webserver.
Q: Who hosts Kreis-bb.de?
A: Kreis-bb.de is hosted by Unknown in .
Q: How much is Kreis-bb.de worth?
A: Kreis-bb.de has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Kreis-bb.de Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Kreis-bb.de Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Kreis-bb.de

H1 Headings

2 :
  1. Gesucht & Gefunden
  2. Social Media

H2 Headings

8 :
  1. Auswirkungen der neuen Corona-Verordnung
  2. Zusammen mit Regionalmarke für ein nachhaltiges Brot
  3. Tag der Daseinsvorsorge am 23. Juni 2021
  4. Der BB-Pfandbecher
  5. Für Sie im Einsatz.
  6. Hinweise
  7. Mehr entdecken
  8. MENÜ

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

34 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

551:

Links - Outbound

42:

Links - Outbound (nofollow)

0:

Keyword Cloud for Kreis-bb.de

fahrdienst frawbversorgungsamtinfosjuniterminemeldung vombreitband pressewirtschaftverwaltungsdienst gehobenerfrbehinderungbackboneplanung aktuell terminevermessungstechnischerihrewohnenaktuellmediaforstbibliothekder backboneplanung aktuelldienstbarrierefreiheitpublikationeneuropafeuerwehrwesenverwaltungleonbergbreitbandveterinrdienstprojektehasa hauptschulabschlusskursehasafahrdienst fr menschenamp politikergebnisse derspracheleichteinformationenleichte sprachefahrdienstservicefreiwilligendienstemenschen mit behinderunghinweisemiddotabfallwirtschaftlandratsamtesmarkercontentmitfr menschen mitpraktikuminfos frvarflurneuordnungbermehrkreisarchivweiterekreisarchiv historische forstbibliothek0datenschutzvermessungstechnischer verwaltungsdienstfamilieausbildungif markercontentlebensmittelberwachungflchtlingebildungstermine breitbandaktuellessozialesvorinteressanterckblick ergebnisse derumweltansprechpartnerformulare1historische forstbibliothekpresse breitbandwebcamdiebildung amp wirtschaftallgemeinederammeldungkreis ampergebnisse der backboneplanungrckblickbesuch desbetreuungamp verwaltungrckblick ergebnisseservice amp verwaltungpresseinteressante linksbesuch des landratsamtesverwaltungsdienstbreitband glossarkreisarchiv historischehistorischekreis amp politikjugendsocial mediamarkercontent if markercontenteinmenschen mitbreitband presse breitbandwerdeabzumtagfahrerlaubniswireinersocialampbildung ampmit behinderungaktuelleklimaschutzveranstaltungenordnungbreitband glossar rckblickder backboneplanungbackboneplanung aktuelldeponielandkreisgehobenerimmenhinweise zum besuchwegweiserbbpfandbecherkommunalenaturschutzvermessungstechnischer verwaltungsdienst gehobenerunsabfallfreiim landkreismapbackboneplanungdes landratsamteszum besuch desausschreibungenglossarsielinkshinweise zumbauenergebnissezum besuchglossar rckblick ergebnisseffnungszeitenintegrationfr menschenbildungcoronadesvombeauftragteifschulenbesuchaktuell terminekontaktweillandratsamtpolitikmenschenbblingenglossar rckblicklandkreis bblingenservice ampaktuell termine breitbandamp wirtschafthauptschulabschlusskurseangeboteklimateilhabebeirattermine breitband pressekreismarkercontent if

Longtail Keyword Density for Kreis-bb.de

KeywordsOccurences
fr menschen mit14
menschen mit behinderung10
kreisarchiv historische forstbibliothek4
vermessungstechnischer verwaltungsdienst gehobener4
hinweise zum besuch3
ergebnisse der backbone-planung3
fahrdienst fr menschen3
breitband presse breitband3
termine breitband presse3
aktuell termine breitband3
backbone-planung aktuell termine3
der backbone-planung aktuell3
breitband glossar rckblick3
rckblick ergebnisse der3
glossar rckblick ergebnisse3
zum besuch des3
bildung amp wirtschaft3
kreis amp politik3
service amp verwaltung3
besuch des landratsamtes3
markercontent if markercontent3
menschen mit14
fr menschen14
mit behinderung10
verwaltungsdienst gehobener6
landkreis bblingen4
interessante links4
kreisarchiv historische4
historische forstbibliothek4
vermessungstechnischer verwaltungsdienst4
breitband presse3
der backbone-planung3
backbone-planung aktuell3
aktuell termine3
termine breitband3
hinweise zum3
presse breitband3
leichte sprache3
rckblick ergebnisse3
fahrdienst fr3
meldung vom3
markercontent if3
if markercontent3
ergebnisse der3
bildung amp3
glossar rckblick3
breitband glossar3
hasa hauptschulabschlusskurse3
amp wirtschaft3
zum besuch3
amp politik3
kreis amp3
im landkreis3
social media3
amp verwaltung3
service amp3
des landratsamtes3
besuch des3
infos fr3
fr32
der22
amp19
menschen18
mit16
im15
breitband10
behinderung10
verwaltungsdienst10
service9
angebote9
presse8
markercontent7
bblingen7
sie7
am7
des7
informationen6
praktikum6
landkreis6
links6
gehobener6
schulen6
awb6
middot6
publikationen6
var6
infos6
wohnen6
zum6
projekte5
hinweise5
ber5
ihre5
abfallfrei5
aktuelles5
bildung5
soziales5
klimaschutz5
besuch5
ausschreibungen5
mehr5
die5
wirtschaft5
datenschutz5
termine4
juni4
vermessungstechnischer4
europa4
bildungs-4
werde4
freiwilligendienste4
kreis4
ffnungszeiten4
aktuelle4
feuerwehrwesen4
fahrerlaubnis4
ordnung4
weitere4
versorgungsamt4
jugend4
umwelt4
weil4
klima4
beauftragte4
landratsamt4
teilhabe-beirat4
corona4
leonberg4
formulare4
veranstaltungen4
interessante4
wir4
uns4
kreisarchiv4
historische4
forstbibliothek4
men3
betreuung3
meldung3
familie3
vom3
fahrdienst3
kommunale3
tag3
webcam3
ein3
ab3
leichte3
03
map3
13
if3
dienst3
landratsamtes3
integration3
einer3
sprache3
glossar3
barrierefreiheit3
bauen3
kontakt3
allgemeine3
deponie3
ansprechpartner3
bb-pfandbecher3
social3
media3
abfallwirtschaft3
flurneuordnung3
naturschutz3
politik3
wegweiser3
lebensmittelberwachung3
veterinrdienst3
flchtlinge3
hasa3
hauptschulabschlusskurse3
vor3
rckblick3
ergebnisse3
backbone-planung3
aktuell3
verwaltung3
ausbildung3

Who hosts Kreis-bb.de?

Kreis-bb.de Hosting Provider Information

Hosted IP Address:Not Applicable
Hosted Hostname:Not Applicable
Service Provider:Unknown
Hosted Country:Not Applicable
Location Latitude:Not Applicable
Location Longitude:Not Applicable
Webserver Software:Apache

Is "Unknown" in the Top 10 Hosting Companies?

Name
Percentage
Unknown
15.7989%
GOOGLE
14.3607%
AS-26496-GO-DADDY-COM-LLC
3.8534%
NAMECHEAP-NET
3.1479%
AMAZON-AES
2.3132%
GoDaddy.com, LLC
2.0763%
UNIFIEDLAYER-AS-1
1.9874%
Fara Negar Pardaz Khuzestan
1.6407%
CONFLUENCE-NETWORK-INC
1.4732%
1&1 Internet AG
1.3797%

HTTP Header Analysis for Kreis-bb.de

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Mon, 28 Jun 2021 23:05:50 GMT
Server: Apache
X-Frame-Options: SAMEORIGIN
X-Content-Type-Options: nosniff
X-Xss-Protection: 1; mode=block
Vary: X-Forwarded-Proto,Accept-Encoding
Last-Modified: Mon, 28 Jun 2021 23:05:08 GMT
ETag: "23ce7-5c5db85525878-gzip"
Accept-Ranges: bytes
Content-Encoding: gzip
Content-Length: 27774
Content-Type: text/html

Kreis-bb.de Domain Nameserver Information

HostIP AddressCountry
ns59.domaincontrol.com 97.74.100.31
ns60.domaincontrol.com 173.201.68.31


Need to find out who hosts Kreis-bb.de?


Domain Registration (WhoIs) information for Kreis-bb.de

 % Restricted rights.
%
% Terms and Conditions of Use
%
% The above data may only be used within the scope of technical or
% administrative necessities of Internet operation or to remedy legal
% problems.
% The use for other purposes, in particular for advertising, is not permitted.
%
% The DENIC whois service on port 43 doesn't disclose any information concerning
% the domain holder, general request and abuse contact.
% This information can be obtained through use of our web-based whois service
% available at the DENIC website:
% http://www.denic.de/en/domains/whois-service/web-whois.html
%
%

Domain: kreis-bb.de
Nserver: ns59.domaincontrol.com
Nserver: ns60.domaincontrol.com
Status: connect
Changed: 2021-04-20T18:21:48+02:00

Websites with Similar Names

Kreis-35.de
kreis-35.de jetzt kaufen!
Kreis-4.de
Startseite
Kreis-alzey-worms.eu
Startseite | Landkreis Alzey-Worms
Kreis-anzeiger.de
Home | Kreis-Anzeiger
Kreis-bb.de
Landkreis Böblingen -Start
Kreis-bergstrasse.de
Kreis Bergstrasse - Home
Kreis-borken.de
Kreis Borken: Kreis Borken
Kreis-borken.digital
buchen | Impfen im Kreis Borken

Recently Updated Websites

Kucingrumahan.com (8 seconds ago.)Acsck9.com (8 seconds ago.)T86226.com (13 seconds ago.)Yournerdybestfriends.com (15 seconds ago.)Livewestchaseapartments.com (19 seconds ago.)Northplattebulletin.com (19 seconds ago.)Keyandgriffingames.com (20 seconds ago.)Masteryinteriors.store (23 seconds ago.)Worldmoneyschool.com (25 seconds ago.)Africamexgroup.com (27 seconds ago.)Dineshgroups.com (29 seconds ago.)Northbranfordlittleleague.com (29 seconds ago.)Relevantperformance.com (29 seconds ago.)Hudsonwaterfronthomevalue.com (36 seconds ago.)Electricaguadassuar.com (38 seconds ago.)Ocsportsperformance.com (40 seconds ago.)Swiftsalvage.net (41 seconds ago.)Novecento.xyz (44 seconds ago.)Disclive.net (46 seconds ago.)Chichatumare.com (48 seconds ago.)Olat.org (52 seconds ago.)Obviouslyforgood.com (56 seconds ago.)Higherpathtreks.com (1 minute ago.)Toyotasd.com (1 minute ago.)Myfabo.com (1 minute 3 seconds ago.)Jawstraining.com (1 minute 4 seconds ago.)Lateliershelter.net (1 minute 4 seconds ago.)Imc-karlsruhe.com (1 minute 5 seconds ago.)Zumbamiami.com (1 minute 6 seconds ago.)Globalexpressrecruiting.org (1 minute 6 seconds ago.)

Recently Searched Keywords

oscar-bashashi (2 seconds ago.)cat surgery (2 seconds ago.)���ֿյ� (2 seconds ago.)learnxinyminutes+typescript (3 seconds ago.)489px (4 seconds ago.)s3seteovulg7---priority-7-primaryoeypqt--focuscomp-jzk9g2a8 (4 seconds ago.)校园奴隶契约 (5 seconds ago.)--qung (6 seconds ago.)seine maritime (6 seconds ago.)maka (7 seconds ago.)service amp (7 seconds ago.)style-kajyxxbmnavcontainerarrowstyle-kajyxxbmnavcontainercenter-direction (8 seconds ago.)antas (9 seconds ago.)bende adjutant warns on the influx of fulani... (11 seconds ago.)dubai classifieds (14 seconds ago.)celebrity news bollywood (16 seconds ago.)brushroll (18 seconds ago.)display italic localplayfairdisplay-italic (20 seconds ago.)bsnl hindi portal (24 seconds ago.)listing leads for real estate agents (25 seconds ago.)top affiliate programs uk (26 seconds ago.)bộ đếm sét (27 seconds ago.)adsizesdesksectionbucket return (29 seconds ago.)atatürk’ü anma yarışları 2012 (35 seconds ago.)wb series (37 seconds ago.)pinoy gay planet (37 seconds ago.)truck tire inner (40 seconds ago.)internetten qr kod ile ödeme (42 seconds ago.)annals definition (42 seconds ago.)info-element-custom-button-wrapper buttoncomp-k3ha7qqp pro-galleryinline-styles (45 seconds ago.)