Супермаркет детских автокресел - торговая сеть Москва.

Safety: Low trust score
Year Founded: 2010
Global Traffic Rank: Unknown
Estimated Worth: $9
Category: Shopping

Супермаркет Детских Автокресел - крупнейший продавец детских сидений для автомобилей в Москве и один из основных поставщиков данной продукции в России.



Domain summary

Last updated
2021-04-12
Domain label
kresla-market
Domain extension
ru
Domain registered:
2010-09-22
Domain updated:
2021-04-12
Domain expires:
2021-09-22
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is kresla-market.ru ranked relative to other sites:

Percentage of visits to kresla-market.ru from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Kresla-market.ru registered?
A: Kresla-market.ru was registered 10 years, 7 months, 22 hours, 21 minutes, 43 seconds ago on Wednesday, September 22, 2010.
Q: When was the WHOIS for Kresla-market.ru last updated?
A: The WHOIS entry was last updated 1 week, 3 days, 22 hours, 21 minutes, 43 seconds ago on Monday, April 12, 2021.
Q: What are Kresla-market.ru's nameservers?
A: DNS for Kresla-market.ru is provided by the following nameservers:
  • ns1.timeweb.ru
  • ns2.timeweb.ru
  • ns3.timeweb.org
  • ns4.timeweb.org
Q: Who is the registrar for the Kresla-market.ru domain?
A: The domain has been registered at RU-CENTER-REG-RIPN.
Q: What is the traffic rank for Kresla-market.ru?
A: Kresla-market.ru has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Kresla-market.ru each day?
A: Kresla-market.ru receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Kresla-market.ru resolve to?
A: Kresla-market.ru resolves to the IPv4 address 5.23.54.37.
Q: In what country are Kresla-market.ru servers located in?
A: Kresla-market.ru has servers located in the Russia.
Q: What webserver software does Kresla-market.ru use?
A: Kresla-market.ru is powered by Nginx/1.12.2 webserver.
Q: Who hosts Kresla-market.ru?
A: Kresla-market.ru is hosted by Comcast Cable Communications, Inc. in Russia.
Q: How much is Kresla-market.ru worth?
A: Kresla-market.ru has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Kresla-market.ru Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Kresla-market.ru Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Kresla-market.ru

H1 Headings

0 :

H2 Headings

8 :
  1. от 0 до 12 мес
  2. от 0 до 7 лет
  3. от 9 мес до 12 лет
  4. от 3 до 12 лет
  5. Бустеры
  6. Уникальные модели
  7. Скидки / Акции / Распродажи
  8. Сеть большая – цены низкие

H3 Headings

0 :

H4 Headings

4 :
  1. Сервисы покупателю
  2. Полезная информация
  3. Видеообзоры
  4. О компании

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

5 :

Total Images

16 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

114:

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Kresla-market.ru

spaceprevents the defaultoptional optionsepreventdefault triggeringfontfamilyarialhelveticasansserif overflowhidden textalignleftslidervertical 312 documentfalse1em importantoptionalnonesuccessfontsize12px fontfamilyarialhelveticasansserif overflowhiddenspace betweenoptional the waynone important2bxfixfontsizeinit objlistautotextalignleft margin4px3fontfamilyarmatasansserifarialmargin4px 0px 0pxdevicetopfalse urlfontsize14px fontfamilyarmatasansserifarialhorizentalobjlistpushnodetrue var objlistajax typenavigator containertrue optionalreadyfunction ajax1 wrap circularfontfamilyarmatasansserifarial overflowhiddenfunctionefunctiontriggeredtextalignleft margin4px 0pxslide in pixelsdesktop1 wrapwrapdocumenthorizontal 2captiontransitionsnewx x xfalse bxfixfontsizeinitcircular documentmouse overfontfamilyarmatasansserifarial overflowhidden textalignleftx xnotdocument readyfunctioncontainerhorizontal 2 verticalleftobjlist onresizetype postjsfolderjsfolderenablevalue is 0eachtextalignleftonresizecircular2 vertical0 smallestvaluethisstopanimatewidthslidefontsize12px fontfamilyarialhelveticasansserifsmallestvalue falsefunction thisstopanimatewidthifvarglobal false urltrue0px padding 0pxonresize true vartouch deviceonresize truefreeze80 0centerspecify and enablepixels defaultdisplay blockarrowtriggering bpopup01overflowhiddenplaypadding 0px0px2 vertical 3postscroll 1options10objlist ifdocument readyfunction ajaxover0px 0pxposition absoluteclickvalue is falsepixelsxmaxfontsize 00mouseblocknot classjquerydcarouseldefaultajaxtouchscaling11urlfontfamilyarialhelveticasansseriffiredspecify0px 0px padding1emcursorsmallestvalue false bxfixfontsizeinitwrap circular documentwrap circularvaluepaddingepreventdefault triggering bpopupbxfixfontsizeinit objlist objlistreadyfunction ajax typesizeclass to createoverflowhidden textalignleft margin4pxgoevente prevents13false bxfixfontsizeinit objlistbackgroundpositionbetween eachoptions to specifypost globalarrow navigatorlinksbar scaling11globalbackgroundslideshowhorizontalobjlist objlist onresizebpopup5pxdragpixels default valueclick eventsmallestvaluetrue var33pximageheightfunctionmsgverticalpause9maxfontsize 0 smallestvaluepointerglobal falseslides containerbetweentriggered epreventdefaultmargin4pxtypeabsolutedefault actionepreventdefaultpositionnavigatorslidesmaxfontsizefontfamilyarialhelveticasansserif overflowhiddenjssorb21fontsize14px fontfamilyarmatasansserifarial overflowhiddenobjlist onresize trueclasscolor333114bxfixfontsizeinitevent is fired12 document readyfunctionlinksbarwhethersuccess functionmsg19pxno4actionfunction e prevents5objlist0px paddingvar objlistfunction e7createimportanttype post globaldisplayheight70instance1 horizontalvar objlist ifbpopup when clickcircular document readyfunctionstepsorientationtriggeringmargin4px 0pxwidthjqueryway0 12navigationpost global falseewidth220overflowhidden textalignleftscrollajax type postreadyfunctionfontsize12px0 smallestvalue falseoptional whetherspace between eachcursor pointer11preventsscroll 1 wrap0 notriggered epreventdefault triggering1 horizontal 212requiredbxreadyfunction1 optional6value is 1default valueobjlist objlistfontsize14px5px jssorb21

Longtail Keyword Density for Kresla-market.ru

KeywordsOccurences
value is 110
event is fired9
document readyfunction ajax9
bpopup when click9
epreventdefault triggering bpopup9
triggered epreventdefault triggering9
prevents the default9
function e prevents9
global false url9
post global false9
type post global9
ajax type post9
readyfunction ajax type9
1 wrap circular7
scroll 1 wrap7
value is 07
0px 0px padding6
margin4px 0px 0px6
text-alignleft margin4px 0px6
overflowhidden text-alignleft margin4px6
font-familyarialhelveticasans-serif overflowhidden text-alignleft6
font-size12px font-familyarialhelveticasans-serif overflowhidden6
font-size14px font-familyarmatasans-serifarial overflowhidden6
0px padding 0px4
font-familyarmatasans-serifarial overflowhidden text-alignleft4
maxfontsize 0 smallestvalue4
var objlist if4
objlist objlist onresize4
bxfixfontsizeinit objlist objlist4
0 smallestvalue false4
smallestvalue false bxfixfontsizeinit4
objlist onresize true4
false bxfixfontsizeinit objlist4
value is false3
slide in pixels3
pixels default value3
space between each3
2 vertical 33
x x x3
class to create3
specify and enable3
onresize true var3
true var objlist3
12 document readyfunction3
circular document readyfunction3
wrap circular document3
horizontal 2 vertical3
1 horizontal 23
options to specify3
optional the way3
default value26
overflowhidden text-alignleft10
1 optional10
click event10
triggering bpopup9
global false9
readyfunction ajax9
ajax type9
type post9
post global9
success functionmsg9
false url9
function e9
e prevents9
default action9
triggered epreventdefault9
epreventdefault triggering9
document readyfunction9
wrap circular7
scroll 17
1 wrap7
font-size12px font-familyarialhelveticasans-serif6
none important6
font-size14px font-familyarmatasans-serifarial6
font-familyarialhelveticasans-serif overflowhidden6
0px padding6
0px 0px6
margin4px 0px6
text-alignleft margin4px6
font-familyarmatasans-serifarial overflowhidden6
2 vertical5
links-bar scaling-114
x x4
touch device4
padding 0px4
onresize true4
function thisstopanimatewidth4
objlist onresize4
objlist objlist4
bxfixfontsizeinit objlist4
false bxfixfontsizeinit4
smallestvalue false4
0 smallestvalue4
maxfontsize 04
objlist if4
var objlist4
1em important4
circular document3
0 03
12 document3
pixels default3
position absolute3
cursor pointer3
-5px jssorb213
display block3
true optional3
optional whether3
mouse over3
0 no3
slides container3
0 123
space between3
between each3
navigator container3
arrow navigator3
vertical 33
optional options3
not class3
1 horizontal3
horizontal 23
true var3
050
149
default36
function30
optional29
value27
important18
var17
false16
0px16
slide14
213
objlist12
overflowhidden12
311
epreventdefault11
left11
410
background-position10
510
padding10
click10
jssorb2110
text-alignleft10
event10
global9
prevents9
bpopup9
triggering9
navigator9
triggered9
action9
functionmsg9
e9
post9
document9
success9
readyfunction9
ajax9
type9
url9
if9
fired9
slideshow8
font-size14px8
true8
vertical8
container8
thisstopanimatewidth8
wrap7
scroll7
jqueryd-carousel7
none7
class7
circular7
font-size12px6
background6
font-familyarmatasans-serifarial6
font-familyarialhelveticasans-serif6
66
margin4px6
display6
-33px6
height6
width6
options6
auto6
not6
each5
enable5
75
position5
scaling-115
x5
play5
pause5
arrow5
-5px5
required5
width2204
horizontal4
links-bar4
1em4
orientation4
desktop4
touch4
device4
height704
specify4
size4
navigation4
center4
84
94
new4
onresize4
bxfixfontsizeinit4
smallestvalue4
maxfontsize4
objlistpushnode4
jsfolderjsfolder4
steps4
color3334
013
103
113
123
horizental3
functione3
jquery3
go3
absolute3
pixels3
bxreadyfunction3
slides3
19px3
over3
133
block3
image3
way3
143
instance3
captiontransitions3
top3
create3
whether3
slider3
freeze3
between3
pointer3
cursor3
no3
mouse3
drag3
space3

Who hosts Kresla-market.ru?

Kresla-market.ru Hosting Provider Information

Hosted IP Address:5.23.54.37
Hosted Hostname:vds-kresla4648.timeweb.ru
Service Provider:Comcast Cable Communications, Inc.
Hosted Country:RussiaRU
Location Latitude:55.7386
Location Longitude:37.6068
Webserver Software:nginx/1.12.2

Is "Comcast Cable Communications, Inc." in the Top 10 Hosting Companies?

Name
Percentage
DoD Network Information Center
16.7387%
GoDaddy.com, LLC
8.5968%
Namecheap, Inc.
4.2653%
Confluence Networks Inc
2.7791%
Google Inc.
2.3954%
Merit Network Inc.
1.8799%
Fara Negar Pardaz Khuzestan
1.8361%
1&1 Internet AG
1.8274%
Amazon.com, Inc.
1.7814%
Cogent Communications
1.6096%
Comcast Cable Communications, Inc.
0.0229%

HTTP Header Analysis for Kresla-market.ru

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx/1.12.2
Date: Mon, 12 Apr 2021 01:41:41 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Vary: HTTPS
X-Powered-By: PHP/7.0.30
P3P: policyref="/bitrix/p3p.xml", CP="NON DSP COR CUR ADM DEV PSA PSD OUR UNR BUS UNI COM NAV INT DEM STA"
X-Powered-CMS: Bitrix Site Manager (bc751e7ccd6de499ea66198ad991ffdf)
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: max-age=172800, private, must-revalidate
Pragma: no-cache
X-Frame-Options: SAMEORIGIN
Content-Encoding: gzip
X-Content-Type-Options: nosniff

Kresla-market.ru Domain Nameserver Information

HostIP AddressCountry
ns1.timeweb.ru 92.53.116.26
ns2.timeweb.ru 92.53.98.100
ns3.timeweb.org 92.53.116.200
ns4.timeweb.org 92.53.98.42


Need to find out who hosts Kresla-market.ru?


Domain Registration (WhoIs) information for Kresla-market.ru

 % By submitting a query to RIPN's Whois Service
% you agree to abide by the following terms of use:
% http://www.ripn.net/about/servpol.html#3.2 (in Russian)
% http://www.ripn.net/about/en/servpol.html#3.2 (in English).

domain: KRESLA-MARKET.RU
nserver: ns1.timeweb.ru.
nserver: ns2.timeweb.ru.
nserver: ns3.timeweb.org.
nserver: ns4.timeweb.org.
state: REGISTERED, DELEGATED, VERIFIED
person: Private Person
registrar: REGRU-RU
admin-contact: http://www.reg.ru/whois/admin_contact
created: 2010-09-22T12:58:59Z
paid-till: 2021-09-22T13:58:59Z
free-date: 2021-10-23
source: TCI

Last updated on 2021-04-12T01:41:30Z

Websites with Similar Names

Kresla-berry.ru
Бескаркасные автокресла BERRY - Фирменный интернет магазин
Kresla-e.ru
Кресла-Е - интернет-магазин офисных кресел в Екатеринбурге
Kresla-market.ru
Супермаркет детских автокресел - торговая сеть Москва.
Kresla-opt.shop
Сайт kresla-opt.shop не настроен на сервере
Kresla-otido.ru
Офисная мебель в Москве - купить с доставкой по выгодным ценам, каталог
Kresla-shop.ru
Интернет магазин кресел 🌟 – купить кресло в интернет магазине недорого в Москве

Recently Updated Websites

Lisaaltamirano.com (1 second ago.)Buyapublishing.org (1 second ago.)Annexed.org (2 seconds ago.)Stallize.com (4 seconds ago.)Opacity0.com (4 seconds ago.)Jburtonmotors.com (5 seconds ago.)Dekormarketi.com (5 seconds ago.)Dirtandhustle.com (5 seconds ago.)Ussjfk.org (6 seconds ago.)Furry4life.org (6 seconds ago.)Bernienlab.com (7 seconds ago.)Lehighhansoncareers.com (7 seconds ago.)Rhinox-lift.com (7 seconds ago.)Fish-ip.com (8 seconds ago.)Phonesms.org (8 seconds ago.)Aradahoney.com (8 seconds ago.)Ifishkansas.com (8 seconds ago.)Narbamplification.com (8 seconds ago.)Svitparketu.net (9 seconds ago.)Coolryde.com (9 seconds ago.)Mintbusinessbroker.com (9 seconds ago.)Slow-science.org (9 seconds ago.)Robllerwines.com (9 seconds ago.)Losangelesfencecompany.com (10 seconds ago.)Thelocalweekly.ca (10 seconds ago.)Herbatykawa.pl (11 seconds ago.)Patieentbillhelp.com (11 seconds ago.)Tintamaxplayadelcarmen.com (11 seconds ago.)Mmehomeservices.com (11 seconds ago.)Cableprofessionals.com (12 seconds ago.)

Recently Searched Keywords

大家字幕组 (1 second ago.)字幕下载 (1 second ago.)collection-carousel slick-list (3 seconds ago.)”companion studies” galleri thomassen, göteborg (4 seconds ago.)tin tức khuyến mãi (5 seconds ago.)335is convertible (7 seconds ago.)партнерская программа (7 seconds ago.)round big icon (8 seconds ago.)czy otrzymam fakturę vat za domenę (10 seconds ago.)margarita (10 seconds ago.)forbes press room (11 seconds ago.)important button-17024-144-163 (13 seconds ago.)buddhist tv live today (14 seconds ago.)pop pop (14 seconds ago.)jqueryorigincodeslideshowdotsvideogallery3removeclassorigincodeslideshowdotsactivevideogallery3addclassorigincodeslideshowdotsdeactivevideogallery3 jqueryorigincodedots origincodecurrentkeyvideogallery3 (16 seconds ago.)donate today (16 seconds ago.)next posts (18 seconds ago.)kisses in the dark (20 seconds ago.)analyses (21 seconds ago.)exactly what you (21 seconds ago.)bonito (22 seconds ago.)chả mực hạ long – đặc sản vịnh hạ long – say đắm mọi thực khách (22 seconds ago.)bunda (22 seconds ago.)bài hát đang chờ duyệt yêu jesus - ân điển (26 seconds ago.)griffe (27 seconds ago.)recent obituaries (28 seconds ago.)mona (29 seconds ago.)tailwind (30 seconds ago.)bring new (31 seconds ago.)turkmenistan (31 seconds ago.)