Krita.org  |  Krita | Digital Painting. Creative Freedom.
Low trust score  | 
Krita.org

Krita.org Website Information

Krita.org has a Low Trust Score, a Statvoo Rank of D, an Alexa Rank of 37,395, a Majestic Rank of 44,967, a Domain Authority of 53% and is not listed in DMOZ.

Krita.org is hosted by Rural Telephone Service Co, Inc. in Germany.
Krita.org has an IP Address of 5.9.99.187 and a hostname of silk.kde.org and runs Apache/2.4.7 (Ubuntu) web server.

The domain krita.org was registered 1 decade 1 year 2 weeks ago by , it was last modified 201 decades 8 years 9 months ago and currently is set to expire 201 decades 8 years 9 months ago.


Whois information for krita.org

Full Whois Lookup for Krita.org Whois Lookup

Domain Name: KRITA.ORG
Registry Domain ID: D153123761-LROR
Registrar WHOIS Server:
Registrar URL: http://www.godaddy.com
Updated Date: 2017-04-28T19:31:52Z
Creation Date: 2008-06-27T22:50:44Z
Registry Expiry Date: 2018-06-27T22:50:44Z
Registrar Registration Expiration Date:
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Reseller:
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Registry Registrant ID: C125757664-LROR
Registrant Name: K Desktop Environment e.V.
Registrant Organization: KDE e.V.
Registrant Street: Schoenhauser Allee 6
Registrant City: Berlin
Registrant State/Province:
Registrant Postal Code: 10119
Registrant Country: DE
Registrant Phone: +49.30202373050
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: Login to show email
Admin ID: C125757673-LROR
Admin Name: K Desktop Environment e.V.
Admin Organization: KDE e.V.
Admin Street: Schoenhauser Allee 6
Admin City: Berlin
Admin State/Province:
Admin Postal Code: 10119
Admin Country: DE
Admin Phone: +49.30202373050
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: Login to show email
Tech ID: C125757670-LROR
Tech Name: K Desktop Environment e.V.
Tech Organization: KDE e.V.
Tech Street: Schoenhauser Allee 6
Tech City: Berlin
Tech State/Province:
Tech Postal Code: 10119
Tech Country: DE
Tech Phone: +49.30202373050
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: Login to show email
Server: A.NS.BYTEMARK.CO.UK
Name Server: B.NS.BYTEMARK.CO.UK
Name Server: C.NS.BYTEMARK.CO.UK
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of WHOIS database: 2017-09-04T02:30:16Z

Who hosts Krita.org?

Krita.org Web Server Information

Hosted IP Address:5.9.99.187
Hosted Hostname:silk.kde.org
Service Provider:Rural Telephone Service Co, Inc.
Hosted Country:GermanyDE
Location Latitude:51
Location Longitude:9
Webserver Software:Apache/2.4.7 (Ubuntu)

HTTP Header Analysis for Krita.org

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Thu, 09 Jul 2015 20:36:02 GMT
Server: Apache/2.4.7 (Ubuntu)
X-Pingback: https://krita.org/xmlrpc.php
Vary: Accept-Encoding
Content-Encoding: gzip
Cache-Control: max-age=0
Expires: Thu, 09 Jul 2015 20:36:02 GMT
Transfer-Encoding: chunked
Content-Type: text/html; charset=UTF-8


Need to find out who hosts Krita.org?

Krita.org Free SEO Report

Website Inpage Analysis for Krita.org

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Krita.org

languagedivfrontpagenewscontainervarelse jquerydonation pagewebkitclippath none clippathdatastringmargintopmarginbottomieget involvedclippathnewtoolswidthmargintop 04emjquery individualrecurringamountfloatdonation page jqueryheaderdecoration heightval else jquerynone clippathbusinessonetimeamountval 1 jqueryheaderdecorationartattrvaluenone1donationif jqueryfree0jqueryindividualonetimeamountjquery individualonetimeamountjquerydocumentreadyfunctionwejquery individualonetimeamount valifhelp1 jquery2blocklocationinsitelanguagechangeval elseyoupageinvolvedwantseevaldisplayemailattrvalue jquerymessagefloat leftelsepage jqueryjajpyou needmediajquery individualonetimehidden attrvaluekritagetnotfontsizefrontpageslideshowleftindividualrecurringamountneed12emjquery businessonetimeamountwebkitclippath04emjustonjapanesesite3keyupfunction if jqueryeveryonebackgroundclippath noneindividualonetimehidden attrvaluejquery individualonetimehiddenval 1keyupfunction iffeaturesheightindividualonetimehiddennone clippath nonedisplay blockwebkitclippath nonebusinessrecurringamountjquery businessrecurringamountindividualonetimeamount valkeyupfunction

Longtail Keyword Density for Krita.org

KeywordsOccurences
keyupfunction if jquery5
jquery individualonetimehidden attrvalue4
val else jquery4
-webkit-clip-path none clip-path4
donation page jquery4
none clip-path none4
jquery individualonetimeamount val3
val 1 jquery3
if jquery5
attrvalue jquery5
keyupfunction if5
jquery individualonetimeamount4
donation page4
jquery individualonetimehidden4
val else4
page jquery4
else jquery4
individualonetimehidden attrvalue4
none clip-path4
-webkit-clip-path none4
clip-path none4
jquery businessrecurringamount3
jquery individualrecurringamount3
jquery businessonetimeamount3
individualonetimeamount val3
get involved3
display block3
margin-top 04em3
you need3
header-decoration height3
val 13
float left3
1 jquery3
jquery29
clip-path14
var14
none13
if13
krita13
height11
val11
margin-top10
attrvalue10
-webkit-clip-path9
08
17
language6
email6
width6
we6
else6
you6
donation6
get5
margin-bottom5
float5
25
keyupfunction5
page5
34
block4
need4
want4
art4
individualonetimeamount4
font-size4
new4
individualonetimehidden4
ie4
businessrecurringamount3
everyone3
header-decoration3
tools3
individualrecurringamount3
businessonetimeamount3
datastring3
message3
frontpage-slideshow3
not3
media3
locationinsite3
background3
12em3
left3
04em3
display3
help3
onjapanesesite3
just3
ja-jp3
divfront-page-news-container3
involved3
features3
jquerydocumentreadyfunction3
languagechange3
see3
free3

What are the nameservers for krita.org?

Krita.org Domain Nameserver Information

HostIP AddressCountry
a.ns.bytemark.co.uk 80.68.80.26United Kingdom United Kingdom
b.ns.bytemark.co.uk 85.17.170.78Netherlands Netherlands
c.ns.bytemark.co.uk 80.68.80.27United Kingdom United Kingdom

Krita.org Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Krita.org is a scam?