Kurumsal.web.tr Favicon Kurumsal.web.tr

Kurumsal.web.tr Website Thumbnail
Checking...
KURUMSAL Firmalar, Şirketler Rehberi
Low trust score
 | 
Add a review Change category Claim this site
KURUMSAL Firmalar, Şirketler web sitesi, sektörel olarak kategorilendirilmiş, şehirlere ayrılmış, kurumsal firmalar rehberidir. tekstil firmalari, bilisim firmalari, sanayi, kurumlar, vakiflar, anonim sirketler, limited sirketler listesi


Domain summary

Domain label
kurumsal
Domain extension
web.tr
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is kurumsal.web.tr ranked relative to other sites:

Percentage of visits to kurumsal.web.tr from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Kurumsal.web.tr registered?
A: Kurumsal.web.tr was registered 2 weeks, 5 days, 15 hours, 47 minutes, 57 seconds ago on Wednesday, September 9, 2020.
Q: When was the WHOIS for Kurumsal.web.tr last updated?
A: The WHOIS entry was last updated 2 weeks, 5 days, 15 hours, 47 minutes, 57 seconds ago on Wednesday, September 9, 2020.
Q: What are Kurumsal.web.tr's nameservers?
A: DNS for Kurumsal.web.tr is provided by the following nameservers:
  • ns2.softlayer.com
  • ns1.softlayer.com
Q: Who is the registrar for the Kurumsal.web.tr domain?
A: The domain has been registered at .
Q: What is the traffic rank for Kurumsal.web.tr?
A: Kurumsal.web.tr has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Kurumsal.web.tr each day?
A: Kurumsal.web.tr receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Kurumsal.web.tr resolve to?
A: Kurumsal.web.tr resolves to the IPv4 address 169.54.174.141.
Q: In what country are Kurumsal.web.tr servers located in?
A: Kurumsal.web.tr has servers located in the United States.
Q: What webserver software does Kurumsal.web.tr use?
A: Kurumsal.web.tr is powered by Nginx webserver.
Q: Who hosts Kurumsal.web.tr?
A: Kurumsal.web.tr is hosted by SoftLayer Technologies Inc. in United States.
Q: How much is Kurumsal.web.tr worth?
A: Kurumsal.web.tr has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Who hosts Kurumsal.web.tr?

Kurumsal.web.tr Hosting Provider Information

Hosted IP Address:169.54.174.141
Hosted Hostname:mail.kurumsal.web.tr
Service Provider:SoftLayer Technologies Inc.
Hosted Country:United StatesUS
Location Latitude:37.751
Location Longitude:-97.822
Webserver Software:nginx

Is "SoftLayer Technologies Inc." in the Top 10 Hosting Companies?

Name
Percentage

HTTP Header Analysis for Kurumsal.web.tr

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx
Date: Wed, 09 Sep 2020 01:11:10 GMT
Content-Type: text/html; charset=utf-8
Content-Length: 6503
Connection: keep-alive
X-Powered-By: PleskLin
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
Vary: Accept-Encoding
Content-Encoding: gzip

Kurumsal.web.tr Domain Nameserver Information

HostIP AddressCountry
ns2.softlayer.com 67.228.255.5
ns1.softlayer.com 67.228.254.4


Need to find out who hosts Kurumsal.web.tr?


WhoIs information for Kurumsal.web.tr

Kurumsal.web.tr Free SEO Report

Website Inpage Analysis for Kurumsal.web.tr

H1 Headings

0 :

H2 Headings

2 :
  1. Sektörlere Göre Firmalar
  2. Şehirlere Göre Firmalar

H3 Headings

2 :
  1. Yeni Eklenen Firmalar
  2. En Popüler

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

1 :

Google Adsense

:
pub-9333208742038965

Google Analytics

:
UA-818431-11

Links - Internal

156:
  1. No text
    http://kurumsal.web.tr/
  2. Firma Ekle
    http://kurumsal.web.tr/firma_ekle.php
  3. Giriş Yap
    http://kurumsal.web.tr/giris.php
  4. Destek
    http://kurumsal.web.tr/sss.php
  5. Yeni Eklenen Firmalar
    http://kurumsal.web.tr/yenieklenenler.php
  6. Kavuklu Et Filesi
    http://kurumsal.web.tr/kavuklu-et-filesi.html
  7. Avukat Gökhan Başkurt
    http://kurumsal.web.tr/avukat-gokhan-baskurt.html
  8. EYAGROUP
    http://kurumsal.web.tr/eyagroup.html
  9. Yağmur Şemsiye
    http://kurumsal.web.tr/yagmur-semsiye.html
  10. Clenbuterol Satın Al - Sporunuyap
    http://kurumsal.web.tr/clenbuterol-satin-al-sporunuyap.html
  11. ÇİKOLATA&ÇİÇEK EVİ ORGANİZASYON
    http://kurumsal.web.tr/cikolata-cicek-evi-organizasyon.html
  12. atölye dekorasyon imalat mobilya
    http://kurumsal.web.tr/atolye-dekorasyon-imalat-mobilya.html
  13. Uzman Psikolog Meltem Demir
    http://kurumsal.web.tr/uzman-psikolog-meltem-demir.html
  14. ONURCAN ENERJİ ELEKTRİK
    http://kurumsal.web.tr/onurcan-enerji-elektrik.html
  15. D.and.P Mass Media Group
    http://kurumsal.web.tr/d-and-p-mass-media-group.html
  16. en son eklenen 50 firma
    http://kurumsal.web.tr/yenieklenenler.php
  17. Çıtır Kahve
    http://kurumsal.web.tr/citir-kahve.html
  18. Velomoto Motorsiklet Akü, Yedek Parç
    http://kurumsal.web.tr/velomoto-motorsiklet-aku-yedek-parca.html
  19. ankara kalıp sistemleri iskele insaat
    http://kurumsal.web.tr/ankara-kalip-sistemleri-iskele-insaat-san-ltd-sti.html
  20. Neşeker Nikah Şekeri & Davetiye
    http://kurumsal.web.tr/neseker-nikah-sekeri-davetiye.html
  21. GeziciYAK Seyahat Acentası
    http://kurumsal.web.tr/geziciyak-seyahat-acentasi.html
  22. Gözde Elektronik
    http://kurumsal.web.tr/gozde-elektronik.html
  23. CİHOZ OTO
    http://kurumsal.web.tr/cihoz-oto.html
  24. Gülşehir Haber Express
    http://kurumsal.web.tr/gulsehir-haber-express.html
  25. Barbaros Gümüş
    http://kurumsal.web.tr/barbaros-gumus.html
  26. BMG Güvenlik ve Alarm sistemleri
    http://kurumsal.web.tr/bmg-guvenlik-ve-alarm-sistemleri.html
  27. Alışveriş Merkezleri Firmaları
    http://kurumsal.web.tr/firmalar/alisveris_merkezleri_firmalari.php
  28. Alüminyum ve Yan Sanayi Firmaları
    http://kurumsal.web.tr/firmalar/aluminyum_ve_yan_sanayi_firmalari.php
  29. Ambalaj ve Yan Sanayi Firmaları
    http://kurumsal.web.tr/firmalar/ambalaj_ve_yan_sanayi_firmalari.php
  30. Arıtma ve Temizlik Firmaları
    http://kurumsal.web.tr/firmalar/aritma_ve_temizlik_firmalari.php
  31. Bahçe ve Ev Firmaları
    http://kurumsal.web.tr/firmalar/bahce_ve_ev_firmalari.php
  32. Basın Yayın Sektörü Firmaları
    http://kurumsal.web.tr/firmalar/basin_yayin_sektoru_firmalari.php
  33. Bilişim Sektörü Firmaları
    http://kurumsal.web.tr/firmalar/bilisim_sektoru_firmalari.php
  34. Birlikler& Dernekler Firmaları
    http://kurumsal.web.tr/firmalar/birlikler&_dernekler_firmalari.php
  35. Büro ve Kırtasiye Malzemeleri Firmaları
    http://kurumsal.web.tr/firmalar/buro_ve_kirtasiye_malzemeleri_firmalari.php
  36. Dekorasyon Firmaları
    http://kurumsal.web.tr/firmalar/dekorasyon_firmalari.php
  37. Diğer Sektörler Firmaları
    http://kurumsal.web.tr/firmalar/diger_sektorler_firmalari.php
  38. Dini Servisler Firmaları
    http://kurumsal.web.tr/firmalar/dini_servisler_firmalari.php
  39. Dış Ticaret Şirketleri Firmaları
    http://kurumsal.web.tr/firmalar/dis_ticaret_sirketleri_firmalari.php
  40. Eğitim Kurumları Firmaları
    http://kurumsal.web.tr/firmalar/egitim_kurumlari_firmalari.php
  41. Eğlence Sektörü Firmaları
    http://kurumsal.web.tr/firmalar/eglence_sektoru_firmalari.php
  42. Elektrik ve Elektronik Sanayi Firmaları
    http://kurumsal.web.tr/firmalar/elektrik_ve_elektronik_sanayi_firmalari.php
  43. Endüstriyel Ürünler Firmaları
    http://kurumsal.web.tr/firmalar/endustriyel_urunler_firmalari.php
  44. Film / Müzik Şirketleri Firmaları
    http://kurumsal.web.tr/firmalar/film___muzik_sirketleri_firmalari.php
  45. Finansal Kuruluşlar Firmaları
    http://kurumsal.web.tr/firmalar/finansal_kuruluslar_firmalari.php
  46. Fotoğraf Sanayi Firmaları
    http://kurumsal.web.tr/firmalar/fotograf_sanayi_firmalari.php
  47. Fuar ve Organizasyon Firmaları
    http://kurumsal.web.tr/firmalar/fuar_ve_organizasyon_firmalari.php
  48. Gıda Sektörü Firmaları
    http://kurumsal.web.tr/firmalar/gida_sektoru_firmalari.php
  49. Güzellik Sektörü Firmaları
    http://kurumsal.web.tr/firmalar/guzellik_sektoru_firmalari.php
  50. Hizmet Sektörü Firmaları
    http://kurumsal.web.tr/firmalar/hizmet_sektoru_firmalari.php
  51. Hobi Firmaları
    http://kurumsal.web.tr/firmalar/hobi_firmalari.php
  52. Holdingler Firmaları
    http://kurumsal.web.tr/firmalar/holdingler_firmalari.php
  53. İthalat/ İhracat Firmaları
    http://kurumsal.web.tr/firmalar/ithalat__ihracat_firmalari.php
  54. Kimya Sanayi Firmaları
    http://kurumsal.web.tr/firmalar/kimya_sanayi_firmalari.php
  55. Maden ve Metal Sektörü Firmaları
    http://kurumsal.web.tr/firmalar/maden_ve_metal_sektoru_firmalari.php
  56. Makine Sanayi Firmaları
    http://kurumsal.web.tr/firmalar/makine_sanayi_firmalari.php
  57. Organize Sanayi Siteleri Firmaları
    http://kurumsal.web.tr/firmalar/organize_sanayi_siteleri_firmalari.php
  58. Ormancılık ve Yan Ürünleri Firmaları
    http://kurumsal.web.tr/firmalar/ormancilik_ve_yan_urunleri_firmalari.php
  59. Otomotiv ve Yan Sanayi Firmaları
    http://kurumsal.web.tr/firmalar/otomotiv_ve_yan_sanayi_firmalari.php
  60. Oyuncak Sanayi Firmaları
    http://kurumsal.web.tr/firmalar/oyuncak_sanayi_firmalari.php
  61. Pazarlama Şirketleri Firmaları
    http://kurumsal.web.tr/firmalar/pazarlama_sirketleri_firmalari.php
  62. Petrol ve Yan Sanayi Ürünleri Firmaları
    http://kurumsal.web.tr/firmalar/petrol_ve_yan_sanayi_urunleri_firmalari.php
  63. Plastik Yan Sanayi Firmaları
    http://kurumsal.web.tr/firmalar/plastik_yan_sanayi_firmalari.php
  64. Savunma Sanayi Firmaları
    http://kurumsal.web.tr/firmalar/savunma_sanayi_firmalari.php
  65. Spor Sektörü Firmaları
    http://kurumsal.web.tr/firmalar/spor_sektoru_firmalari.php
  66. Tekstil Firmaları
    http://kurumsal.web.tr/firmalar/tekstil_konfeksiyon_firmalari.php
  67. Turizm Firmaları
    http://kurumsal.web.tr/firmalar/turizm_firmalari.php
  68. Ulaşım ve Taşımacılık Firmaları
    http://kurumsal.web.tr/firmalar/ulasim_ve_tasimacilik_firmalari.php
  69. Yapı Sektörü Firmaları
    http://kurumsal.web.tr/firmalar/yapi_sektoru_firmalari.php
  70. Yerel Yönetimler Firmaları
    http://kurumsal.web.tr/firmalar/yerel_yonetimler_firmalari.php
  71. Ziraat Sektörü Firmaları
    http://kurumsal.web.tr/firmalar/ziraat_sektoru_firmalari.php
  72. Adana
    http://kurumsal.web.tr/sehirler/adana_firmalari.php
  73. Adıyaman
    http://kurumsal.web.tr/sehirler/adiyaman_firmalari.php
  74. Afyon
    http://kurumsal.web.tr/sehirler/afyon_firmalari.php
  75. Ağrı
    http://kurumsal.web.tr/sehirler/agri_firmalari.php
  76. Aksaray
    http://kurumsal.web.tr/sehirler/aksaray_firmalari.php
  77. Amasya
    http://kurumsal.web.tr/sehirler/amasya_firmalari.php
  78. Ankara
    http://kurumsal.web.tr/sehirler/ankara_firmalari.php
  79. Antalya
    http://kurumsal.web.tr/sehirler/antalya_firmalari.php
  80. Ardahan
    http://kurumsal.web.tr/sehirler/ardahan_firmalari.php
  81. Artvin
    http://kurumsal.web.tr/sehirler/artvin_firmalari.php
  82. Aydın
    http://kurumsal.web.tr/sehirler/aydin_firmalari.php
  83. Balıkesir
    http://kurumsal.web.tr/sehirler/balikesir_firmalari.php
  84. Bartın
    http://kurumsal.web.tr/sehirler/bartin_firmalari.php
  85. Batman
    http://kurumsal.web.tr/sehirler/batman_firmalari.php
  86. Bayburt
    http://kurumsal.web.tr/sehirler/bayburt_firmalari.php
  87. Bilecik
    http://kurumsal.web.tr/sehirler/bilecik_firmalari.php
  88. Bingöl
    http://kurumsal.web.tr/sehirler/bingol_firmalari.php
  89. Bitlis
    http://kurumsal.web.tr/sehirler/bitlis_firmalari.php
  90. Bolu
    http://kurumsal.web.tr/sehirler/bolu_firmalari.php
  91. Burdur
    http://kurumsal.web.tr/sehirler/burdur_firmalari.php
  92. Bursa
    http://kurumsal.web.tr/sehirler/bursa_firmalari.php
  93. Çanakkale
    http://kurumsal.web.tr/sehirler/canakkale_firmalari.php
  94. Çankırı
    http://kurumsal.web.tr/sehirler/cankiri_firmalari.php
  95. Çorum
    http://kurumsal.web.tr/sehirler/corum_firmalari.php
  96. Denizli
    http://kurumsal.web.tr/sehirler/denizli_firmalari.php
  97. Diyarbakır
    http://kurumsal.web.tr/sehirler/diyarbakir_firmalari.php
  98. Düzce
    http://kurumsal.web.tr/sehirler/duzce_firmalari.php
  99. Edirne
    http://kurumsal.web.tr/sehirler/edirne_firmalari.php
  100. Elazığ
    http://kurumsal.web.tr/sehirler/elazig_firmalari.php
  101. Erzincan
    http://kurumsal.web.tr/sehirler/erzincan_firmalari.php
  102. Erzurum
    http://kurumsal.web.tr/sehirler/erzurum_firmalari.php
  103. Eskişehir
    http://kurumsal.web.tr/sehirler/eskisehir_firmalari.php
  104. Gaziantep
    http://kurumsal.web.tr/sehirler/gaziantep_firmalari.php
  105. Giresun
    http://kurumsal.web.tr/sehirler/giresun_firmalari.php
  106. Gümüşhane
    http://kurumsal.web.tr/sehirler/gumushane_firmalari.php
  107. Hakkari
    http://kurumsal.web.tr/sehirler/hakkari_firmalari.php
  108. Hatay
    http://kurumsal.web.tr/sehirler/hatay_firmalari.php
  109. İçel
    http://kurumsal.web.tr/sehirler/icel_firmalari.php
  110. Iğdır
    http://kurumsal.web.tr/sehirler/igdir_firmalari.php
  111. Isparta
    http://kurumsal.web.tr/sehirler/isparta_firmalari.php
  112. İstanbul
    http://kurumsal.web.tr/sehirler/istanbul_firmalari.php
  113. İzmir
    http://kurumsal.web.tr/sehirler/izmir_firmalari.php
  114. Kahramanmaraş
    http://kurumsal.web.tr/sehirler/kahramanmaras_firmalari.php
  115. Karabük
    http://kurumsal.web.tr/sehirler/karabuk_firmalari.php
  116. Karaman
    http://kurumsal.web.tr/sehirler/karaman_firmalari.php
  117. Kars
    http://kurumsal.web.tr/sehirler/kars_firmalari.php
  118. Kastamonu
    http://kurumsal.web.tr/sehirler/kastamonu_firmalari.php
  119. Kayseri
    http://kurumsal.web.tr/sehirler/kayseri_firmalari.php
  120. Kilis
    http://kurumsal.web.tr/sehirler/kilis_firmalari.php
  121. Kırıkkale
    http://kurumsal.web.tr/sehirler/kirikkale_firmalari.php
  122. Kırklareli
    http://kurumsal.web.tr/sehirler/kirklareli_firmalari.php
  123. Kırşehir
    http://kurumsal.web.tr/sehirler/kirsehir_firmalari.php
  124. KKTC
    http://kurumsal.web.tr/sehirler/kktc.php
  125. Kocaeli
    http://kurumsal.web.tr/sehirler/kocaeli_firmalari.php
  126. Konya
    http://kurumsal.web.tr/sehirler/konya_firmalari.php
  127. Kütahya
    http://kurumsal.web.tr/sehirler/kutahya_firmalari.php
  128. Malatya
    http://kurumsal.web.tr/sehirler/malatya_firmalari.php
  129. Manisa
    http://kurumsal.web.tr/sehirler/manisa_firmalari.php
  130. Mardin
    http://kurumsal.web.tr/sehirler/mardin_firmalari.php
  131. Muğla
    http://kurumsal.web.tr/sehirler/mugla_firmalari.php
  132. Muş
    http://kurumsal.web.tr/sehirler/mus_firmalari.php
  133. Nevşehir
    http://kurumsal.web.tr/sehirler/nevsehir_firmalari.php
  134. Niğde
    http://kurumsal.web.tr/sehirler/nigde_firmalari.php
  135. Ordu
    http://kurumsal.web.tr/sehirler/ordu_firmalari.php
  136. Osmaniye
    http://kurumsal.web.tr/sehirler/osmaniye_firmalari.php
  137. Rize
    http://kurumsal.web.tr/sehirler/rize_firmalari.php
  138. ŞanlıUrfa
    http://kurumsal.web.tr/sehirler/s.urfa_firmalari.php
  139. Sakarya
    http://kurumsal.web.tr/sehirler/sakarya_firmalari.php
  140. Samsun
    http://kurumsal.web.tr/sehirler/samsun_firmalari.php
  141. Siirt
    http://kurumsal.web.tr/sehirler/siirt_firmalari.php
  142. Sinop
    http://kurumsal.web.tr/sehirler/sinop_firmalari.php
  143. Şırnak
    http://kurumsal.web.tr/sehirler/sirnak_firmalari.php
  144. Sivas
    http://kurumsal.web.tr/sehirler/sivas_firmalari.php
  145. Tekirdağ
    http://kurumsal.web.tr/sehirler/tekirdag_firmalari.php
  146. Tokat
    http://kurumsal.web.tr/sehirler/tokat_firmalari.php
  147. Trabzon
    http://kurumsal.web.tr/sehirler/trabzon_firmalari.php
  148. Tunceli
    http://kurumsal.web.tr/sehirler/tunceli_firmalari.php
  149. Uşak
    http://kurumsal.web.tr/sehirler/usak_firmalari.php
  150. Van
    http://kurumsal.web.tr/sehirler/van_firmalari.php
  151. Yalova
    http://kurumsal.web.tr/sehirler/yalova_firmalari.php
  152. Yozgat
    http://kurumsal.web.tr/sehirler/yozgat_firmalari.php
  153. Zonguldak
    http://kurumsal.web.tr/sehirler/zonguldak_firmalari.php
  154. Ana Sayfa
    http://kurumsal.web.tr/
  155. Gizlilik Politikası ve Genel Şartlar
    http://kurumsal.web.tr/gizlilik-politikasi.php
  156. İletişim
    http://kurumsal.web.tr/iletisim.php

Links - Internal (nofollow)

0:

Links - Outbound

4:
  1. Dolar
    http://tr.excrates.com/USDTRY.html
  2. Euro
    http://tr.excrates.com/EURTRY.html
  3. Altın
    http://tr.excrates.com/XAUTRY.html
  4. € / $
    http://tr.excrates.com/EURUSD.html

Links - Outbound (nofollow)

0:

Keyword Cloud for Kurumsal.web.tr

sektr firmalarekleyanve yan sanayikurumsalwebtrve yanfirmairketleriyapsanayisveyan sanayi firmalarsektrfirmalaryan sanayisanayi firmalarvarsongreirketleri firmalar

Longtail Keyword Density for Kurumsal.web.tr

KeywordsOccurences
ve yan sanayi4
yan sanayi firmalar4
sanayi firmalar10
sektr firmalar10
ve yan5
yan sanayi5
irketleri firmalar3
firmalar48
ve16
sanayi12
sektr10
yan6
var4
firma4
s3
son3
ekle3
yap3
kurumsalwebtr3
gre3
irketleri3

Kurumsal.web.tr Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Kurumsal.web.tr is a scam?

Websites with Similar Names

Kurum-al.com
HostGator Web Hosting Website Startup Guide
Kuruma-110.com
廃車手続き&車・バイク・原付の廃車費用
Kuruma-88.com
???????? | Just another WordPress site
Kuruma-anzen.com
自動車保険・自動車事故 情報まとめサイト
Kuruma-areba.com
クルマアレバ – カーシェアリングを利用して生活の幅を広げてみる
Kuruma-bumper.com
?????? – Just another WordPress site
Kuruma-c.com
マイカーコミュニティ
Kuruma-chiebukuro.link
??????? – ??????????????????????????????????
Kuruma-city.net
????????????????????????????

Recently Updated Websites

Aristocratawning.com 2 seconds ago.Keeponliving.at 2 seconds ago.Visioncircle.org 3 seconds ago.Broadway-shows.org 3 seconds ago.Repcom.hr 3 seconds ago.Marxentlabs.com 4 seconds ago.Angelositalianmarket.com 5 seconds ago.Trangtricuoi.com 5 seconds ago.4healthtraveldent.com 6 seconds ago.Cruisethekimberley.net 6 seconds ago.Markoandplacemakers.com 6 seconds ago.Marincountyparks.org 6 seconds ago.Scream.org 6 seconds ago.Fancyfrancis.com 7 seconds ago.S-textile.ru 7 seconds ago.Tomaszjaraczewski.com 8 seconds ago.Organizerportland.com 9 seconds ago.Triflow-spares.com 9 seconds ago.Babiestobiceps.com 10 seconds ago.Christopheraucoin.com 10 seconds ago.Presentible.com 11 seconds ago.Dial4legal.com 11 seconds ago.Hope4uruguay.com 12 seconds ago.Highwaywomen.com 12 seconds ago.Tavernonline.com 12 seconds ago.Rollitinglitter.co.uk 12 seconds ago.Rtptest.org 12 seconds ago.Brittneymurphydesign.com 12 seconds ago.Witheridge-historical-archive.com 13 seconds ago.Pregonandolaverdad.org 13 seconds ago.