Low trust score  | 



Labbaikhajjumrah.co.uk Website Information

Website Ranks & Scores for Labbaikhajjumrah.co.uk

Statvoo Rank Statvoo Rank:I
Alexa Rank Alexa Rank:0
Majestic Rank Majestic Rank:0
Domain Authority Domain Authority:0%
DMOZ DMOZ Listing:No

Whois information for labbaikhajjumrah.co.uk

Full Whois Lookup for Labbaikhajjumrah.co.uk Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Labbaikhajjumrah.co.uk. Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

Domain name:
labbaikhajjumrah.co.uk

Data validation:
Nominet was able to match the registrant's name and address against a 3rd party data source on 29-Jun-2018

Registrar:
GoDaddy.com, LLP. [Tag = GODADDY]
URL: http://uk.godaddy.com

Relevant dates:
Registered on: 18-Jan-2017
Expiry date: 18-Jan-2020
Last updated: 11-Jul-2018

Registration status:
Registered until expiry date.

Name servers:
ns1.uk45.siteground.eu
ns2.uk45.siteground.eu

WHOIS lookup made at 16:08:11 01-Feb-2019

--
This WHOIS information is provided for free by Nominet UK the central registry
for .uk domain names. This information and the .uk WHOIS are:

Copyright Nominet UK 1996 - 2019.

You may not access the .uk WHOIS or use any data from it except as permitted
by the terms of use available in full at https://www.nominet.uk/whoisterms,
which includes restrictions on: (A) use of the data for advertising, or its
repackaging, recompilation, redistribution or reuse (B) obscuring, removing
or hiding any or all of this notice and (C) exceeding query rate or volume
limits. The data is provided on an 'as-is' basis and may lag behind the
register. Access may be withdrawn or restricted at any time.

Who hosts Labbaikhajjumrah.co.uk?

Labbaikhajjumrah.co.uk is hosted by in .
Labbaikhajjumrah.co.uk has an IP Address of and a hostname of .



Labbaikhajjumrah.co.uk Web Server Information

Hosted IP Address:Not Applicable
Hosted Hostname:Not Applicable
Service Provider:Not Applicable
Hosted Country:Not Applicable
Location Latitude:Not Applicable
Location Longitude:Not Applicable
Webserver Software:Not Applicable
Google Map of 50,12

Websites Hosted on Same IP (i.e. )

Nevada NewsMakers
- nevadanewsmakers.com

  10,919,449   $ 8.95

Ligmincha France et Suisse romande
- ligmincha.fr

  4,500,519   $ 240.00

Comment gagner de l'argent? Voici le TOP pour gagner des euros!
- leclubargent.com

Toutes les solutions pour gagner de l'argent rapidement et facilement au quotidien et sur internet. Le Club Argent c'est 100% fiable!

  Not Applicable   $ 0.00

Ecozen - Agriculture Technology | Post Harvest management |...
- ecozensolutions.com

Ecozen Solution is Technology in agriculture driven product Development Company provides renewable energy based products to increase farmer income.

  Not Applicable   $ 0.00

UK Write My Essay
- ukwritemyessay.com

  Not Applicable   $ 0.00

HTTP Header Analysis for Labbaikhajjumrah.co.uk



Need to find out who hosts Labbaikhajjumrah.co.uk?

Labbaikhajjumrah.co.uk Free SEO Report

Website Inpage Analysis for Labbaikhajjumrah.co.uk

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Labbaikhajjumrah.co.uk

selfcallwedays makkah4star hotel3 star hotel3 starhavelabbaik4 starpackages 2018people sharingtransportationhajjlabbaik hajj umrah2nowourbookingushajj packagesumrahcontact4 star hotelrequirednights 3starfaresdaysdealshajj and umrahyourumrah packagespackages durationavailabledurationdolabbaik hajjnoperformfunctionreturnanyhotelshiftinghotel in makkahsharinghajj umrahtraveltheyalservicesflightsvarpackagepackagespackages callvisamorenights 3 starukmadinapeopleprovideall1flightmakkahpackages call nowcannightscall nowstartmedinahagentshotel in madinapaymentmuslims3madina starthotelspxbreakcase0whichmore packages callmore packagesyounow 0203865695002038656950call now 02038656950makkah madina

Longtail Keyword Density for Labbaikhajjumrah.co.uk

KeywordsOccurences
labbaik hajj umrah12
hajj and umrah5
hotel in makkah5
call now 020386569504
3 star hotel4
4 star hotel3
nights 3 star3
hotel in madina3
more packages call3
packages call now3
labbaik hajj14
hajj umrah14
star hotel8
packages 20186
umrah packages6
3 star5
4 star4
hajj packages4
call now4
now 020386569504
days makkah3
packages duration3
makkah madina3
nights 33
madina start3
more packages3
packages call3
people sharing3
hajj35
umrah33
packages24
you17
labbaik14
hotel14
makkah13
we12
star12
our11
package9
09
18
nights8
28
travel7
all7
have7
your6
available6
us6
madina6
uk6
start5
do5
now5
35
days5
more5
020386569505
they4
provide4
services4
perform4
hotels4
no4
call4
visa4
self4
sharing3
people3
required3
muslims3
shifting3
var3
can3
functionreturn3
which3
fares3
flight3
agents3
any3
transportation3
payment3
booking3
43
duration3
flights3
medinah3
deals3
contact3
al3
pxbreakcase3

What are the nameservers for labbaikhajjumrah.co.uk?

Labbaikhajjumrah.co.uk Domain Nameserver Information

HostIP AddressCountry
ns1.uk45.siteground.eu 77.104.173.243Romania Romania
ns2.uk45.siteground.eu 77.104.180.117Romania Romania

Alexa Traffic Rank for Labbaikhajjumrah.co.uk


Alexa Search Engine Traffic for Labbaikhajjumrah.co.uk