Lacreperiecafe.net Favicon Lacreperiecafe.net

Lacreperiecafe.net Website Thumbnail
Checking...
La Creperie Cafe | French Restaurant | Long Beach
Low trust score
Add a review Change category Claim this site
La Creperie Cafe. Artsy French eatery with sidewalk seating, dishing up sweet & savory crêpes, sandwiches & pasta.


Domain summary

Domain label
lacreperiecafe
Domain extension
net
Domain registered:
2002-04-11
Domain updated:
2019-06-20
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is lacreperiecafe.net ranked relative to other sites:

Percentage of visits to lacreperiecafe.net from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Lacreperiecafe.net registered?
A: Lacreperiecafe.net was registered 18 years, 5 months, 2 weeks, 5 days, 3 hours, 51 minutes, 22 seconds ago on Thursday, April 11, 2002.
Q: When was the WHOIS for Lacreperiecafe.net last updated?
A: The WHOIS entry was last updated 1 year, 3 months, 1 week, 3 days, 3 hours, 51 minutes, 22 seconds ago on Thursday, June 20, 2019.
Q: What are Lacreperiecafe.net's nameservers?
A: DNS for Lacreperiecafe.net is provided by the following nameservers:
  • ns4.wixdns.net
  • ns5.wixdns.net
Q: Who is the registrar for the Lacreperiecafe.net domain?
A: The domain has been registered at TIERRANET INC. D/B/A DOMAINDISCOVER.
Q: What is the traffic rank for Lacreperiecafe.net?
A: Lacreperiecafe.net has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Lacreperiecafe.net each day?
A: Lacreperiecafe.net receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Lacreperiecafe.net resolve to?
A: Lacreperiecafe.net resolves to the IPv4 address 23.236.62.147.
Q: In what country are Lacreperiecafe.net servers located in?
A: Lacreperiecafe.net has servers located in the United States.
Q: What webserver software does Lacreperiecafe.net use?
A: Lacreperiecafe.net is powered by webserver.
Q: Who hosts Lacreperiecafe.net?
A: Lacreperiecafe.net is hosted by Google Inc. in California, Mountain View, United States, 94043.
Q: How much is Lacreperiecafe.net worth?
A: Lacreperiecafe.net has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Who hosts Lacreperiecafe.net?

Lacreperiecafe.net Hosting Provider Information

Hosted IP Address:23.236.62.147
Hosted Hostname:147.62.236.23.bc.googleusercontent.com
Service Provider:Google Inc.
Hosted Country:United StatesUS
Location Latitude:37.4043
Location Longitude:-122.0748
Webserver Software:Not Applicable

Is "Google Inc." in the Top 10 Hosting Companies?

Name
Percentage

HTTP Header Analysis for Lacreperiecafe.net

Http-Version: 1.1
Status-Code: 301
Status: 301 Moved Permanently
Date: Thu, 10 Sep 2020 09:57:57 GMT
Content-Length: 0
Connection: keep-alive
location: https://www.lacreperiecafe.net/
content-language: en
X-Wix-Request-Id: 1599731877.31034218046254856333
Age: 0
Server-Timing: cache;desc=miss, varnish;desc=miss, dc;desc=42
X-Seen-By: gv/XVF9HsGpk8A2KWukUzOwfbs 7qUVAqsIx00yI78k=,sHU62EDOGnH2FBkJkG/Wx8EeXWsWdHrhlvbxtlynkVjfPSLurEWIBzqevPmP0aiw,2d58ifebGbosy5xc FRalvll1yuABm9advK99kEWokjeXLSXMBcNA1TCRTFrtfkGBvcfZuHc6956yvjzr3SJKg==,2UNV7KOq4oGjA5 PKsX47BzxWFBtKoqbaB2M/rwsEsk=,m0j2EEknGIVUW/liY8BLLmYVHm1DtakfzSOTrFG0wKU=,1wy2ILu/S4rlWT/R4rqCreOuqniDiABj7ubb6dkWSZM=,iNzairCM74Jm 18Ga2HaNf2nFIXkJPbODpfFI90P0mQaWyug/ZdHQ36uOAkr89T0,WSO u2BWDrxZld83W5N69mPpOFe5uq4gLaFlYCh7g29a4hrXo3HQQUAC4Zmt6cDYWIHlCalF7YnfvOr2cMPpyw==
Cache-Control: no-cache
Expires: -1

Lacreperiecafe.net Domain Nameserver Information

HostIP AddressCountry
ns4.wixdns.net 216.239.36.101
ns5.wixdns.net 216.239.38.101


Need to find out who hosts Lacreperiecafe.net?


WhoIs information for Lacreperiecafe.net

 Domain Name: LACREPERIECAFE.NET
Registry Domain ID:
Registrar WHOIS Server: whois.domaindiscover.com
Registrar URL: https://www.tierra.net
Updated Date: 2019-06-19T18:30:22Z
Creation Date: 2002-04-11T07:08:52Z
Registrar Registration Expiration Date: 2021-04-11T03:08:52Z
Registrar: TIERRANET INC. DBA DOMAINDISCOVER
Registrar IANA ID: 86
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.6193932105
Reseller:
Domain Status: ok https://icann.org/epp#ok
Registry Registrant ID:
Registrant Name: Jeff Almaz
Registrant Organization: La Creperie Cafe
Registrant Street: 6466 frampton circle
Registrant City: huntigton beach
Registrant State/Province: CA
Registrant Postal Code: 92648
Registrant Country: US
Registrant Phone: +1.5622549228
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: Login to show email
Admin ID:
Admin Name: JEFF ALMAZ
Admin Organization: Creperie Express
Admin Street: 2201 CALLE MARGARITA
Admin City: SAN DIMAS
Admin State/Province: CA
Admin Postal Code: 91773
Admin Country: US
Admin Phone: +1.2134220409
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: Login to show email
Tech ID:
Tech Name: Jeff Almaz
Tech Organization: La Creperie Cafe
Tech Street: 6466 frampton circle
Tech City: huntigton beach
Tech State/Province: CA
Tech Postal Code: 92648
Tech Country: US
Tech Phone: +1.5622549228
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: Login to show email
Server: NS4.WIXDNS.NET
Name Server: NS5.WIXDNS.NET
DNSSEC:
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
For more information on Whois status codes, please visit https://icann.org/epp
>>> Last update of WHOIS database: 2020-07-07T00:22:03Z

Lacreperiecafe.net Free SEO Report

Website Inpage Analysis for Lacreperiecafe.net

H1 Headings

5 :
  1. Long Beach at La Creperie Cafe
  2. ADDRESS - 4911 E 2nd St,
  3. Long Beach, CA 90803
  4. PHONE - (562) 434-8499

H2 Headings

1 :
  1. - Our Menus - 

H3 Headings

1 :
  1. Escape to France without leaving

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

14 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

7:
  1. #mask-comp-jx0rjc01img-svg * {fill: #fff; stroke: #fff; stroke-width: 0;}
    https://www.lacreperiecafe.net
  2. Home
    https://www.lacreperiecafe.net
  3. Specials
    https://www.lacreperiecafe.net/specials
  4. Gallery
    https://www.lacreperiecafe.net/gallery
  5. Employment
    https://www.lacreperiecafe.net/employment
  6. Contact
    https://www.lacreperiecafe.net/contact
  7. #mask-comp-jxm35sdfimg-svg * {fill: #fff; stroke: #fff; stroke-width: 0;}
    https://www.lacreperiecafe.net

Links - Internal (nofollow)

0:

Links - Outbound

6:
  1. Escape to France without leaving
    https://web.archive.org/web/20171114180220/http://www.presstelegram.com/2015/01/14/escape-to-france-without-leaving-long-beach-at-la-creperie-cafe/
  2. Long Beach at La Creperie Cafe
    https://web.archive.org/web/20171114180220/http://www.presstelegram.com/2015/01/14/escape-to-france-without-leaving-long-beach-at-la-creperie-cafe/
  3. PHONE - (562) 434-8499
    https://www.google.com/search?q=LA+CREPERIE+CAFE+PHONE&oq=LA+CREPERIE+CAFE+PHONE&aqs=chrome..69i57j0j69i60l3j0.5071j0j7&sourceid=chrome&ie=UTF-8#
  4. No text
    https://www.facebook.com/LaCreperie1/
  5. No text
    https://www.instagram.com/lacreperiecafe/
  6. No text
    https://www.yelp.com/biz/la-creperie-caf%C3%A9-long-beach-4

Links - Outbound (nofollow)

0:

Keyword Cloud for Lacreperiecafe.net

cafe artsyf9f8f6colorrgb249 248galleryitemwrappergalleryitemtopinfo infoelementcustombuttonwrapper246 importantcompjx0ufbh550pxheight 4pxwidth 4pxmarginsatingalleryitemcontainerinverthover061eb garamondserifcustombuttonfontcolorforhover f9f8f6colorf9f8f6normal 15px18px avenirltw0135light1475496sansseriftextdecorationf9f8f6 stylejx3uiweh27 25compjx1b5lwe progalleryinlinestylesprofullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestyles fullscreensidebardescriptionbuttonnotprogallerylovednotinfoelementlovedcompjx1b5lwe progalleryinlinestyles1loadmorebuttoncolor 1d1b19loadmorebuttonfontinfoelementdescriptionitemdescriptionfontslideshow normal normalimportantcompjx1b5lwe progalleryinlinestyles galleryitemcontainerprogallerymobileindicatorgalleryitemwrapper galleryitemloadwithcolorimageloadingcolor 1d1b19backgroundcolorrgb107linotypeserif colorf9f8f6compjx0ufbh5 progalleryinlinestyles galleryitemcontainerprogallerymobileindicatorpurchase0cursor pointercolorsvg galleryitemsvgbackgrounditemopacity15px14em quoteb0positionbeachpageuriseohomehidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidc1kcbjx19m7fybgmetadatapageidc1kcbispresetfalseschemaversion20ishiddenfalsemediareftypeimageidc1kcbdesktopmediarefmetadatapageidc1kcbispresetfalseschemaversion20ishiddenfalsetitlered satin texturejpguri4c991a96acd2f5d77f42aebb7e865e1f830f71mv2jpgdescriptionprivatewidth1024height765altartistidnameopacity1colorcolor15aligntypecenterfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewportmobilecustomtruereftypebackgroundmediaidcustombgimgb7vmetadatapageidc1kcbispresetfalseschemaversion20ishiddenfalsemediareftypeimageidc1kcbmobilemediarefmetadatapageidc1kcbispresetfalseschemaversion20ishiddenfalsetitleredtransparentbordergalleryitemwrapper galleryitemhover svginfoelementdescriptionitemdescriptionfontcolorslideshow f9f8f6itemdescriptionfontslideshowsavory crpes sandwichesprogalleryinlinestyles galleryitemcontainernotinverthover1backgroundcolorrgba255 255 255f9f8f6backgroundrgba156 153 150249 1backgroundcolorrgba255 25522px14em1custombuttonbordercolor 1d1b19custombuttonfontgalleryslideshowinfo galleryitemtitlecompjx1b5lwe progalleryinlinestyles153 150 06galleryitemcontainer galleryitemtextdivprogalleryparentcontainer1d1b19colorrgb245 237f9f8f6itemdescriptionfontslideshowgalleryitemdescriptioncompjx0ufbh518pxyour itemnormal normal 24px14emimportantcompjx1b5lwenowraptextoverflowmedia15px14em eb garamondseriftextdecorationf9f8f6descriptionfontexpand15px14em eb garamondserifitemdescriptionfontcolor25 061 importantcompjx0ufbh5ultxtnewgaramondseriftextdecoration background2itemsavenirltw0185heavy1475544sansseriftextdecoration compjx1b5lwe progalleryinlinestyles150 06 importantcompjx1b5lwegalleryslideshowinfo galleryitemtitlecompjx0ufbh5 progalleryinlinestylesstylejx3uiwehmusicplayer2534280964rootmusicplayer2534280964hassinglerowf9f8f6descriptionfontexpand normalnormal 15px14em quotebinfoelementcustombuttonwrapper buttoncustombuttonborderradius 0custombuttonborderwidthf9f8f6backgroundrgba29 27inotprogallerylovednotinfoelementlovedcompjx0ufbh5normal 22px27pxgalleryitemtext custombuttonwrappergalleryslideshowinfo infoelementcustombuttonwrapper buttoncustombuttonfontforhoverhelveticaw01lighthelveticaw02lightsansseriftextdecoration compjx0ufbh5 progalleryinlinestylesinfoelementcustombuttonwrapper buttoncustombuttonfontforhovergfill bba28bgalleryitemtopinfo custombuttonwrapper12n nninfosvgtypeshapeviewbox0buttoncompjx1b5lweeb garamondserifcolorrgb249 24822px14em georgiapalatinobookgalleryslideshowinfo acolorrgb249none stylejx3uiwehinfoelementdescriptioncompjx0ufbh5 progalleryinlinestylesblockwidth248 246 importantcompjx0ufbh5ishowmorecolorrgba0 0long beachpageuriseohomehidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidc1kcbjx19m7fybgmetadatapageidc1kcbispresetfalseschemaversion20ishiddenfalsemediareftypeimageidc1kcbdesktopmediarefmetadatapageidc1kcbispresetfalseschemaversion20ishiddenfalsetitlered satinsandwiches pastametakeywordsseopagetitleseola creperienonebeachtypemetapropsnamedescriptioncontentlaborderwidth2px borderstylesolidbordercolorrgba249 249wixinsetavenirltw0135light1475496sansseriftextdecoration compjx1b5lwegaramondserifcolorf9f8f6savory crpes000000248 246fontnormal normalsandwiches pastametakeywordsseopagetitleseolaf9f8f6loadmorebuttonborderwidth 1loadmorebuttoncolor 1d1b19loadmorebuttonfontgalleryitemsvgforegroundfillrgb2490custombuttonborderwidth 1custombuttonbordercolor 1d1b19custombuttonfontinotprogallerylovedcompjx1b5lwe profullscreenwrapperprogalleryinlinestyles galleryitemcontainerprogallerymobileindicator galleryitemtextnowraptextoverflow ellipsis stylejx3uiweh980px27 25 importantfontnormalavenirltw0135light1475496sansseriftextdecoration compjx1b5lwe progalleryinlinestylesinherittransitionstylejx3tvtjrnavcontainerarrowcomplete1custombuttonbordercolor 1d1b19custombuttonfont normalseating dishingprogalleryinlinestyles galleryitemcontainerprogallerymobileindicator galleryitemtopinfocreperie cafe artsyobjectartsy frenchgalleryitemhoverdefaultforcehoverbeforecompjx1b5lwe progalleryinlinestylesgalleryitemhoverbeforeitemopacity f9f8f6backgroundrgba29 273dishing uplong beachtypemetapropsnamedescriptioncontentlaimportantcompjx1b5lwe progalleryinlinestyles galleryitemcontainernot1backgroundcolorrgba255 255stylejx3uiwehmusicplayer2534280964rootmusicplayer2534280964ishoverstatecustombuttonwrapper buttoncompjx0ufbh5galleryitembottominfo custombuttonwrapperbackgroundnormal normal 38px47px246compjx1b5lwe profullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestyles25 061pastametakeywordsseopagetitleseola creperie cafe5galleryitemgalleryitemvideo50px27 25compjx0ufbh5 profullscreenwrapper15px18pxigalleryitemvideoplaytriangleitemfontcolor0backgroundeb garamondseriftextdecoration compjx0ufbh5galleryitemhover infoelementtitleitemfontcompjx1b5lwe progalleryinlinestyles galleryitemcontainerstoryacompjx0ufbh5 profullscreenwrappereb garamondseriftextdecorationf9f8f6colorrgb249galleryitemhoverbeforeitemopacity24pxbuttoncustombuttonborderradius 0custombuttonborderwidth15px14em eb garamondserifloadmorebuttonfontcolormargin0lineheightnormalletterspacingnormal txtnewgradienttopitemopacity112 74 1garamondseriftextdecoration27 25 061relativetransition all 03seatery with sidewalknormal 24px14em georgiapalatinobook255 255 1imageseb garamondserifcustombuttonfontcolorforhover204 204infoelementdescriptionitemdescriptionfont normal normal1d1b19loadmorebuttonfont906 importantcompjx1b5lwe progalleryinlinestylescrpes sandwiches pastametakeywordsseopagetitleseolacompjx0ufbh5 progalleryinlinestylesprogalleryinlinestyles galleryitemcontainer galleryitembottominfogalleryitemwrapper galleryitemhover infoelementtitleitemfontdishinggalleryitemtextnormal 22px27px avenirltw0185heavy1475544sansseriftextdecorationgaramondserifloadmorebuttonfontcolorgalleryitemcontainer galleryitemwrapper galleryitemhoverpathfill0width 100heightgalleryslideshowinfo galleryitemdescriptioncompjx0ufbh5 progalleryinlinestylesborderstylesolidbordercolorrgba249tryborderwidth2px borderstylesolidbordercolorrgba249248 246transparentborder 0borderradius27 25compjx1b5lwe profullscreenwrapperbuttoncustombuttonfontforhover normal normal0borderradiusn n nninfosvgtypeshapeviewbox0texturejpguri4c991a96acd2f5d77f42aebb7e865e1f830f71mv2jpgdescriptionprivatewidth1024height765altartistidnameopacity1colorcolor15aligntypecenterfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewportmobilecustomtruereftypebackgroundmediaidcustombgimgb7vmetadatapageidc1kcbispresetfalseschemaversion20ishiddenfalsemediareftypeimageidc1kcbmobilemediarefmetadatapageidc1kcbispresetfalseschemaversion20ishiddenfalsetitleredinotprogallerylovedcompjx0ufbh5 profullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestylesstylejx3tvtjrnavcontainerarrow stylejx3tvtjrnavcontainersvgcontainerrestaurant long beachpageuriseohomehidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidc1kcbjx19m7fybgmetadatapageidc1kcbispresetfalseschemaversion20ishiddenfalsemediareftypeimageidc1kcbdesktopmediarefmetadatapageidc1kcbispresetfalseschemaversion20ishiddenfalsetitleredstylejx3uiweh musicplayer2534280964titlebuttoncompjx0ufbh5 profullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestyles03sprogalleryinlinestyles galleryitemcontainerprogallerymobileindicator galleryslideshowinfogeorgiapalatinobook antiquapalatinoimportantzindex50galleryitemwrapper galleryslideshowinfo svgcompjx1b5lwecurrentcolorborderradiusinfoelementtitlecompjx1b5lwe progalleryinlinestylesacompjx1b5lwe profullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestyles246 importantcompjx1b5lwe50px stylejx3uiwehimportantfontnormal normalgaramondserifcustombuttonfontcolorforhover f9f8f6colorf9f8f6 importantfontnormalprofullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestylestexturejpguri4c991a96acd2f5d77f42aebb7e865e1f830f71mv2jpgdescriptionprivatewidth1024height765altartistidnameopacity1colorcolor15aligntypecenterfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimageadvancedseodatatagstypetitlechildrenla creperie cafegalleryitemhover infoelementdescriptionitemdescriptionfonthelveticasatin texturejpguri4c991a96acd2f5d77f42aebb7e865e1f830f71mv2jpgdescriptionprivatewidth1024height765altartistidnameopacity1colorcolor15aligntypecenterfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimageadvancedseodatatagstypetitlechildrenla22px27px helveticaw01boldhelveticaw02boldhelveticaltw10boldsansseriftextdecoration1d1b19backgroundcolorrgb107 104visitors09fontnormal normalprogalleryinlinestyles galleryitemcontainerinverthoverstylejx3tvtjrnavcontainerarrowstylejx3tvtjrnavcontainerrightdirection255 1 stylejx3tvtjrnavcontainernormal normal 15px18pxpastametakeywordsseopagetitleseola creperiegalleryitemtitlecompjx0ufbh5 progalleryinlinestyles41d1b19loadmorebuttonfont normalgalleryslideshowinfo galleryitemdescriptioncompjx1b5lwe progalleryinlinestyleseb garamondserifitemdescriptionfontcolorslideshow f9f8f6colorrgb24917normal normalbba28b stylejx3uiwehmusicplayer2534280964rootrelativetransition allgalleryitemwrapper galleryitemhover infoelementcustombuttonwrappercustombuttonfontcolorbackgroundcolorstylegalleryslideshowinfo galleryitemtitlecompjx0ufbh5246fontnormal normal normalgalleryitemtitlecompjx1b5lweushiddenwhitespace nowraptextoverflow ellipsislinotypeserifcontacthelveticaw01boldhelveticaw02boldhelveticaltw10boldsansseriftextdecorationtechnical issuerestaurant long beachtypemetapropsnamedescriptioncontentlabuttoncompjx1b5lwe progalleryinlinestyles galleryitemcontainercenter stylejx3uiweh1d1b19backgroundcolorrgb29 27compjx1b5lwe progalleryinlinestyles815px14em eb garamondserifcustombuttonfontcolorforhoverantiquapalatino linotypeseriftextdecorationinfoelementdescriptionitemdescriptionfont normalnormal 14px14em ebprofullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestyles fullscreensidebarsocialgalleryitemcontainerprogallerymobileindicator galleryslideshowinfo06 importantcompjx1b5lwecalc100 980px 05garamondserifitemdescriptionfontcolorslideshow f9f8f6colorrgb249dishing up sweetcreperie0loadmorebuttonbordercolor f9f8f6loadmorebuttonborderwidth 1loadmorebuttoncolornormal normal normalprogalleryinlinestylescafe artsy frenchinotprogallerylovedcompjx0ufbh5musicplayer2534280964trackwrapperhoverfullscreenviewfullscreenbrightprofullscreeninlinestyles fullscreennav246 importantcompjx0ufbh5 progalleryinlinestylesblockpadding 0border04sstylejx3tvtjrrepeaterbuttonlabelopencompjx0ufbh5 profullscreenwrappercolor 4s easetransparentoutline 0cursor pointercolor1crpesgalleryitemloadwithcolorimageloadingcolor 1d1b19backgroundcolorrgb107 10425compjx1b5lwe profullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestylesimportantleftautocanfullscreenviewfullscreenbrightprofullscreeninlinestyles fullscreenmobilebarfffborder 0borderradius27 25compjx1b5lweinfoelementcustombuttonwrappercustombuttonfontcolor f9f8f6colorf9f8f60custombuttonborderwidth 1custombuttonbordercolorgalleryitemcontainer galleryitembottominfo21galleryitemcontainer galleryitemtopinfostore140px16246 importantcompjx1b5lwe progalleryinlinestylesf9f8f6backgroundrgba156georgiapalatinobook antiquapalatino linotypeserifitemfontcolorableacompjx0ufbh5 profullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestylesimportantcompjx0ufbh5 progalleryinlinestyles galleryitemcontainerprogallerymobileindicator15px14emgalleryitemloadwithcolorimageloadingcolorpayment09fontnormalgalleryitemdescriptioncompjx1b5lwe progalleryinlinestyles110border 0background transparentoutlinemusicplayer2534280964titlegalleryitemwrapper galleryslideshowinfoslideshowarrowarrowscolorgalleryitemcontainerprogallerymobileindicatornotinverthovercafebackgroundrgb29galleryitemtitlecompjx0ufbh5 progalleryinlinestyles galleryitemcontainerprogallerymobileindicatorgaramondserifitemdescriptionfontcolor 1d1b19colorrgb29 27galleryitemwrapper galleryslideshowinfo acolorrgb249inherittransition color 4s139 importantcompjx0ufbh5 progalleryinlinestylesacompjx1b5lwenormal 24px14em248 246 importantfontnormalprogalleryinlinestyles galleryitemcontainergalleryitemwrapper galleryslideshowinfo infoelementdescriptionitemdescriptionfontslideshowgalleryslideshowinfo infoelementdescriptionitemdescriptionfontcolorslideshow f9f8f6itemdescriptionfontslideshowinfoelementdescriptionitemdescriptionfontslideshow normalsvg g gfillgeorgiapalatinobook antiquapalatino linotypeseriftextdecoration12pxinfoelementcustombuttonwrapper buttoncustombuttonborderradius1d1b19colorrgb24525compjx0ufbh51 stylejx3tvtjrnavcontainerselectdataerrortruenormal normal 15px14em248 246compjx0ufbh5 profullscreenwrappercompjx1b5lwe profullscreenwrapperantiquapalatino linotypeserifitemfontcolornormal 40px14em georgiapalatinobookg pathnthoftype2fillgalleryitemwrapper galleryitemhovergaramondserifitemdescriptionfontcolor 1d1b19colorrgb29f9f8f6descriptionfontexpand normal normal0 stylejx3uiwehyour visitorspositionfixed importantleftauto1custombuttonbordercolor40px14emsatin texturejpguri4c991a96acd2f5d77f42aebb7e865e1f830f71mv2jpgdescriptionprivatewidth1024height765altartistidnameopacity1colorcolor15aligntypecenterfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewportmobilecustomtruereftypebackgroundmediaidcustombgimgb7vmetadatapageidc1kcbispresetfalseschemaversion20ishiddenfalsemediareftypeimageidc1kcbmobilemediarefmetadatapageidc1kcbispresetfalseschemaversion20ishiddenfalsetitleredgalleryitemhoverdefaultnothidehoverbeforebackgroundf9f8f6 importantcompjx0ufbh5 progalleryinlinestyles6buttoncustombuttonborderradius 0custombuttonborderwidth 1custombuttonbordercolornormal normal 40px14emprogalleryinlinestyles galleryitemcontainer galleryitemtext0borderradius 50pxheightg gfill bba28btransparent 140pxgalleryitemhover svg1 stylejx3uiwehmusicplayer2534280964root4pxwidth 4pxmarginfullscreensidebardescription150 06acompjx1b5lwe profullscreenwrappermusicplayer2534280964trackactionsdisplayacolorrgb249 2484sgpositionabsolutetop0right0bottom0left038px47pxselecthover6px255 255newselectdatapreviewerror15px14em eb garamondserifcolorrgb249galleryitemcontainerprogallerymobileindicator galleryitemwrapper galleryitemhoverimportantfontnormalniconnefantasyeb garamondserifcolorrgb249yougaramondserifitemdescriptionfontcolorslideshow f9f8f6colorrgb249 248galleryitemdescriptioncompjx1b5lwe1d1b19fillrgb29texturejpguri4c991a96acd2f5d77f42aebb7e865e1f830f71mv2jpgdescriptionprivatewidth1024height765altartistidnameopacity1colorcolor15aligntypecenterfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewportmobilecustomtruereftypebackgroundmediaidcustombgimgb7vmetadatapageidc1kcbispresetfalseschemaversion20ishiddenfalsemediareftypeimageidc1kcbmobilemediarefmetadatapageidc1kcbispresetfalseschemaversion20ishiddenfalsetitlered satinfullscreenviewfullscreenbrightprofullscreeninlinestyles fullscreensocial24px14empreviewgalleryitemhoverdefaultforcehoverbeforecompjx1b5lwef9f8f6itemdescriptionfontslideshow normallinotypeserifitemfontcolorslideshow f9f8f6colorrgb249texturejpguri4c991a96acd2f5d77f42aebb7e865e1f830f71mv2jpgdescriptionprivatewidth1024height765altartistidnameopacity1colorcolor15aligntypecenterfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimageadvancedseodatatagstypetitlechildrenla creperie4s ease opacityprogalleryinlinestyles galleryitemcontainerprogallerymobileindicatorbuttonnotprogallerylovednotinfoelementlovedcompjx0ufbh5 progalleryinlinestylesaccept onlinegalleryitemhoveritemiconcolorinotprogallerylovednotinfoelementlovedcompjx1b5lwearialimportantcompjx1b5lwe progalleryinlinestyles14normal 22px14emgalleryitemdescriptioncompjx0ufbh5 progalleryinlinestyles25 importantcompjx1b5lwe progalleryinlinestylesf9f8f6backgroundrgba156 153galleryitemcontainer25compjx1b5lwe progalleryinlinestylesgalleryslideshowinfo infoelementdescriptionitemdescriptionfontslideshowopacity 4s easeeb garamondserifitemdescriptionfontcolorslideshoweaterybuttoncompjx1b5lwe progalleryinlinestylesseating dishing upgalleryslideshowinfo infoelementcustombuttonwrappergaramondserifcolorrgb249 24850pxheight25 importantfontnormalsidewalk seating dishingus to completeinfoelementdescriptionitemdescriptionfontcolorslideshowset upigalleryitemvideoplaybackgrounditemopacitytxtnew1074 1creperie cafeclickgaramondseriftextdecoration compjx0ufbh5absolutetopbba28bf9f8f6colorf9f8f6 importantfontnormal normalantiquapalatino linotypeserifitemfontcolorslideshow f9f8f6colorrgb249currentcolortransition colorprofullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestyles fullscreennavbuttonshowmoreloadmorebuttonborderradiuslonggalleryitemhoverbeforeitemopacity f9f8f6backgroundrgba156 153progalleryinlinestyles galleryitemcontainerprogallerymobileindicatorinverthover15px18px avenirltw0135light1475496sansseriftextdecorationcrpes sandwichessweet savory crpes0custombuttonborderwidthpositionfixedstylejx0zwoi6bggalleryitemhover gradienttopitemopacitygalleryitemhover infoelementcustombuttonwrappercustombuttonfontcolor15px14em eb garamondserifgalleryitemdescriptioncompjx0ufbh5 progalleryinlinestyles galleryitemcontainerprogallerymobileindicator14px14em ebcalc100infoelementdescriptioncompjx1b5lwepointercolor inherittransition248 246fontnormalfullscreenviewfullscreenbrightprofullscreeninlinestyles fullscreensidebarsocialprofullscreenwrapper4pxmargin 0position0 transparentf9f8f6backgroundrgba29selectdatapreviewhoverbuttoncompjx0ufbh5 progalleryinlinestyles galleryitemcontainerebcompjx1b5lwe profullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestylesinfoelementtitleitemfontslideshow normalgalleryitemwrapper galleryitemhoveritemiconcolordivprogalleryparentcontainer showmorecontainerlong beachpageuriseohomehidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidc1kcbjx19m7fybgmetadatapageidc1kcbispresetfalseschemaversion20ishiddenfalsemediareftypeimageidc1kcbdesktopmediarefmetadatapageidc1kcbispresetfalseschemaversion20ishiddenfalsetitlered4s ease stylejx3uiwehinfoelementtitlecompjx1b5lwe061 importantcompjx0ufbh525compjx1b5lwegalleryitemhoverdefaultforcehoverbeforecompjx0ufbh5 progalleryinlinestylesellipsis50pxheight 100userselect1d1b19custombuttonfont normaltexturejpguri4c991a96acd2f5d77f42aebb7e865e1f830f71mv2jpgdescriptionprivatewidth1024height765altartistidnameopacity1colorcolor15aligntypecenterfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimageadvancedseodatatagstypetitlechildrenla0position relativetransitioncafe french7svg gfill bba28b1d1b19fillrgb29 27stylejx3tvtjrnavcontainertransparentoutline 0cursorcomplete yournninfosvgtypeshapeviewbox0 0g gfillgaramondserifitemdescriptionfontcolorslideshow22112 74progalleryinlinestyles galleryitemcontainer galleryitemtopinfosvg galleryitemsvgforegroundfillrgb249 248ishowmorecolorrgba0french restaurant longease opacitygaramondserifcolorf9f8f6 importantfontnormal normalantiquapalatino linotypeserifgalleryitemhover infoelementtitleitemfont normalsatin texturejpguri4c991a96acd2f5d77f42aebb7e865e1f830f71mv2jpgdescriptionprivatewidth1024height765altartistidnameopacity1colorcolor15aligntypecenterfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewportmobilecustomtruereftypebackgroundmediaidcustombgimgb7vmetadatapageidc1kcbispresetfalseschemaversion20ishiddenfalsemediareftypeimageidc1kcbmobilemediarefmetadatapageidc1kcbispresetfalseschemaversion20ishiddenfalsetitlered satinup yourgalleryitemcontainer galleryitemwrapper galleryslideshowinfo0 0sweetgalleryitemtitlecompjx1b5lwe progalleryinlinestylesnormal normal 22px27pxnormal 22px14em georgiapalatinobookgalleryitemcontainerprogallerymobileindicator galleryitemtopinfoopacitygfill bba28b stylejx3uiweh4pxwidthgalleryitemwrapper galleryitemhover custombuttonwrapper22px27px avenirltw0185heavy1475544sansseriftextdecoration compjx1b5lweinfoelementcustombuttonwrapper buttoncompjx0ufbh5 progalleryinlinestyles061 importantcompjx0ufbh5 progalleryinlinestylesfullscreenviewfullscreenbrightprofullscreeninlinestylesnowraptextoverflow ellipsisvarcustomersborderwidth2px246compjx0ufbh5 profullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestylescolortopautobottom0normal normal 22px14emeb garamondserifitemdescriptionfontcolor09fontnormal normal normalgalleryitembottominfo246 importantfontnormal normalhelveticaw01lighthelveticaw02lightsansseriftextdecorationrgba153 112 74galleryslideshowinfo custombuttonwrapperpositionfixed importantleftauto importantzindex50normalcompjx0ufbh5helvetica arialacceptavenirltw0185heavy1475544sansseriftextdecoration0loadmorebuttonbordercolor f9f8f6loadmorebuttonborderwidthstylejx3tvtjrnavcontainerarrowstylejx3tvtjrnavcontainercenterdirectioninfoelementtitlecompjx0ufbh5 progalleryinlinestylesgalleryitemhoverdefaultnothidehoverbeforebackgroundf9f8f6your paymentinotprogallerylovedcompjx1b5lwenormal 15px18px helveticaw01lighthelveticaw02lightsansseriftextdecorationmusicplayer2534280964trackactions4pxwidth 4pxmargin 0positionsetinfoelementtitleitemfont normalgalleryitemhoverbeforeitemopacity f9f8f6backgroundrgba29divprogalleryparentcontainer showmorecontainerprogallerymobileindicatormanagegaramondserifcolorrgb249 248 246fontnormalnormal 22px27px helveticaw01boldhelveticaw02boldhelveticaltw10boldsansseriftextdecoration246compjx0ufbh5 profullscreenwrapper1d1b19backgroundcolorrgb29oltransparentborder 0borderradius 50pxheightfalseinfoelementcustombuttonwrapper24px14em georgiapalatinobook antiquapalatino22px27pxpointercolorpayment methodinfoelementdescriptionitemdescriptionfontcolorslideshow f9f8f6itemdescriptionfontslideshow normal162 139 importantcompjx0ufbh5inotprogallerylovednotinfoelementlovedcompjx0ufbh5 progalleryinlinestylesmarginleft calc100 980pxgalleryslideshowinfo svg galleryitemsvgforegroundfillrgb249svg ggalleryslideshowinfoitemiconcolorslideshowgaramondseriftextdecoration compjx1b5lwe25 importantfontnormal normalgalleryslideshowinfo infoelementdescriptionitemdescriptionfontcolorslideshowsandwiches1974 1 stylejx3uiwehmusicplayer2534280964rootrgba249buttonnotprogallerylovednotinfoelementlovedcompjx0ufbh50border 0backgroundcolor 4slb1itemscontainer14px14em153 15027 25 importantcompjx1b5lwe13custombuttonwrapper buttoncompjx1b5lwegalleryitemsvgforegroundfillrgb249 248buttoncustombuttonborderradiuseasef9f8f6loadmorebuttonborderwidthtransparent0borderradius 50pxheight 4pxwidthbuttonshowmoreloadmorebuttonborderradius 0loadmorebuttonbordercolor f9f8f6loadmorebuttonborderwidthn nquotebgaramondserifcustombuttonfontcolorforhoverbuttoncustombuttonfontforhovergalleryitemtitlecompjx0ufbh5 progalleryinlinestyles galleryitemcontainergalleryitemsvgbackgrounditemopacity04s easegalleryitemwrapper galleryitemhover infoelementcustombuttonwrappergalleryitemwrapper galleryitemhover infoelementdescriptionitemdescriptionfonthiddenwhitespaceinfoelementdescriptionitemdescriptionfontstylejx3uiwehmusicplayer2534280964rootease stylejx3uiwehcolorf9f8f6backgroundrgb29 271loadmorebuttoncolor 1d1b19loadmorebuttonfont normalgalleryitemhoveracolorrgb24915px14em ebgalleryitemhover infoelementcustombuttonwrapper buttoncustombuttonborderradiuscafe french restaurant246fontnormalcompjx0ufbh5 profullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestyles05upgalleryitemhoverdefaultforcehoverbeforecompjx0ufbh5galleryitemhoverdefaultnothidehoverbeforebackgroundf9f8f6 importantcompjx1b5lwe progalleryinlinestyles25 importantcompjx1b5lwe249 1backgroundcolorrgba25515buttonnotprogallerylovednotinfoelementlovedcompjx1b5lwehelveticaw01boldhelveticaw02boldhelveticaltw10boldsansseriftextdecoration compjx0ufbh5 progalleryinlinestylesflexjustifycontentgeorgiapalatinobookgalleryitemhover infoelementcustombuttonwrappercustombuttonfontcolor f9f8f6colorf9f8f6eb garamondseriftextdecoration backgroundlinotypeseriftextdecoration compjx1b5lwefullscreennavbeachpageuriseohomehidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidc1kcbjx19m7fybgmetadatapageidc1kcbispresetfalseschemaversion20ishiddenfalsemediareftypeimageidc1kcbdesktopmediarefmetadatapageidc1kcbispresetfalseschemaversion20ishiddenfalsetitleredfont normal normalgalleryitemwrapper galleryslideshowinfo infoelementtitleitemfontslideshoweb garamondserifgalleryitemtitlecompjx1b5lwe progalleryinlinestyles galleryitemcontainerprogallerymobileindicatormusicplayer2534280964activemarginleftgalleryitemhover infoelementdescriptionitemdescriptionfont normal27 25creperie cafe frenchgalleryitemcontainerprogallerymobileindicator galleryitemwrapper galleryitemgalleryitemvideocolor f9f8f6acolorrgb249 248 2460position relativetransition allup sweetprogalleryinlinestyles galleryitemcontainerprogallerymobileindicatornotinverthoverinfoelementdescriptionitemdescriptionfontslideshow40px14em georgiapalatinobook antiquapalatinogalleryitemhover svg galleryitemsvgbackgrounditemopacityborderstylesolidbordercolorrgba249 2491loadmorebuttoncolorfffhelveticaw01boldhelveticaw02boldhelveticaltw10boldsansseriftextdecoration compjx0ufbh5rgba249 248catchy1d1b19colorrgb29garamondserifcolorf9f8f6 importantfontnormalinotprogallerylovednotinfoelementlovedcompjx1b5lwe progalleryinlinestylespastametakeywordsseopagetitleseola25compjx0ufbh5 profullscreenwrapperfrenchn18px stylejx3uiwehavenirltw0185heavy1475544sansseriftextdecoration compjx1b5lweseating808080 stylejx3uiwehartnormal normal 14px14emgalleryitemcontainer galleryitemwrapper galleryitemgalleryitemvideogaramondseriftextdecoration backgroundrgb29progalleryinlinestyles galleryitemcontainer galleryitemwrapper248 246compjx1b5lwe profullscreenwrapperb0b0b0up your payment1d1b19colorrgb29 27 251d1b19colorrgb29 271backgroundcolorrgba255oldirrtlcustombuttonwrapper buttoncompjx1b5lwe progalleryinlinestylesnormal 14px14emeb garamondserifcolorf9f8f6galleryitemtitlecompjx1b5lwe progalleryinlinestyles galleryitemcontainerinfoelementtitleitemfont normal normalbutcolorbba28bultxtnew oltxtnew ul0width15px14em eb garamondserifcolorf9f8f6garamondserifcolorrgb249infoelementcustombuttonwrapper buttoncustombuttonfontforhover normalgalleryitemwrapper galleryitemgalleryitemvideo igalleryitemvideoplaytriangleitemfontcolorgalleryitemtopinfolinotypeserifitemfontcolorslideshoweb garamondserifitemdescriptionfontcolor 1d1b19colorrgb29hiddenwhitespace nowraptextoverflowgalleryitemhover custombuttonwrapperlinotypeseriftextdecorationimportantcompjx0ufbh5 progalleryinlinestylesselectfocuscentergalleryitemwrapper galleryitemhover gradienttopitemopacityonlineplaypausebtnmusicplayer2534280964disabledtwocolors svgselectdatapreviewfocusf9f8f6stylejx3tvtjrnavcontainerrightdirectiongeorgiapalatinobook antiquapalatino linotypeserifitemfontcolorslideshowcompjx0ufbh5 progalleryinlinestyles galleryitemcontainercurrentcolortransitionfrench eaterycompjx1b5lwe progalleryinlinestyles galleryitemcontainerprogallerymobileindicator246compjx0ufbh5ffffffgalleryitemwrapper galleryslideshowinfoitemiconcolorslideshowgalleryslideshowinfo infoelementtitleitemfontslideshow normalellipsis stylejx3uiweh24px14em georgiapalatinobooksvg gfill15px18px avenirltw0135light1475496sansseriftextdecoration compjx1b5lweaddingeb garamondseriftextdecoration backgroundrgb29progalleryinlinestyles galleryitemcontainer galleryslideshowinfoscale3georgiapalatinobook antiquapalatino linotypeserifol ulf9f8f6colorf9f8f6 importantfontnormalfullscreensidebarsociallong beachtypemetapropsnamedescriptioncontentla creperiegalleryitemgalleryitemvideo igalleryitemvideoplaytriangleitemfontcolorf9f8f6colorrgb249 248 246pathnthoftype2fillgalleryitemhoverdefaultnothidehoverbeforebackgroundf9f8f6 importantcompjx0ufbh50loadmorebuttonbordercolorgalleryitemcontainer galleryslideshowinforelativetransitionmargin0lineheightnormalletterspacingnormalstylejx3uiwehitemnormal 15px14em ebulfrench restaurant15px18px helveticaw01lighthelveticaw02lightsansseriftextdecorationup sweet savorysvggalleryitemtext infoelementcustombuttonwrappergalleryitemgalleryitemvideo igalleryitemvideoplaybackgrounditemopacityeb garamondserifloadmorebuttonfontcolor1d1b19loadmorebuttonfont normal normaltransparentoutlinerestaurantstylejx3uiweh musicplayer2534280964activecustombuttonwrapper buttoncompjx0ufbh5 progalleryinlinestylesgalleryitemsvgforegroundfillrgb249 248 246profullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestyles fullscreensocial162 139helveticaw01lighthelveticaw02lightsansseriftextdecoration compjx0ufbh5255 10background transparentoutlinegetfffborder 0borderradius 50pxheightf9f8f6colorf9f8f6satin texturejpguri4c991a96acd2f5d77f42aebb7e865e1f830f71mv2jpgdescriptionprivatewidth1024height765altartistidnameopacity1colorcolor15aligntypecenterfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimageadvancedseodatatagstypetitlechildrenla creperieshowmorecontainerimage20businessinotprogallerylovedcompjx1b5lwe profullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestylesinotprogallerylovedcompjx0ufbh5 profullscreenwrappersvg g pathnthoftype2fill246compjx1b5lwe profullscreenwrapperbeachtypemetapropsnamedescriptioncontentla creperie cafeserverimportantcompjx0ufbh5 progalleryinlinestyles galleryitemcontainerissuegaramondseriftextdecoration backgroundrgb29 27galleryitemcontainer galleryitemwrapperrgba153 11215px18px helveticaw01lighthelveticaw02lightsansseriftextdecoration compjx0ufbh5linotypeserifitemfontcolor1d1b19colorrgb29 27 25compjx1b5lwegaramondseriftextdecoration compjx0ufbh5 progalleryinlinestyles980px 05borderstylesolidbordercolorrgba249 249 249your payment methodinfoelementcustombuttonwrapper buttoncompjx1b5lweishowmorecolorrgba0 0 0importantfontnormal normal normalgalleryitemwrapper galleryitemgalleryitemvideo igalleryitemvideoplaybackgrounditemopacity25compjx1b5lwe profullscreenwrappergfillgalleryslideshowinfo svg246fontnormal normalgaramondseriff9f8f6itemdescriptionfontslideshow normal normalgoinfoelementtitleitemfontslideshow normal normalinfoelementtitleitemfontslideshow1d1b19custombuttonfont normal normalsidewalkart storebuttoncompjx1b5lwe progalleryinlinestyles galleryitemcontainerprogallerymobileindicatorimportantcompjx0ufbh5galleryitemloadwithcolorimageloadingcolor 1d1b19backgroundcolorrgb10706eb garamondserifcolorf9f8f6 importantfontnormalacompjx0ufbh5texturejpguri4c991a96acd2f5d77f42aebb7e865e1f830f71mv2jpgdescriptionprivatewidth1024height765altartistidnameopacity1colorcolor15aligntypecenterfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewportmobilecustomtruereftypebackgroundmediaidcustombgimgb7vmetadatapageidc1kcbispresetfalseschemaversion20ishiddenfalsemediareftypeimageidc1kcbmobilemediarefmetadatapageidc1kcbispresetfalseschemaversion20ishiddenfalsetitlered satin texturejpguri4c991a96acd2f5d77f42aebb7e865e1f830f71mv2jpgdescriptionprivatewidth1024height765altartistidnameopacity1colorcolor15aligntypecenterfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimageadvancedseodatatagstypetitlechildrenla248 246 importantcompjx1b5lwecustombuttonwrapperinfoelementcustombuttonwrapper buttoncompjx0ufbh51d1b19custombuttonfontgalleryitemwrapper galleryitemloadwithcolorimageloadingcolorinfoelementcustombuttonwrappercustombuttonfontcolor248 246compjx0ufbh5infoelementtitlecompjx0ufbh5antiquapalatino linotypeserif colorf9f8f6galleryitemcontainernotinverthoverantiquapalatinomethodbuttoncompjx0ufbh5 profullscreenwrapperslideshowarrowarrowscolor 1d1b19fillrgb29 27font normalblockpaddinggalleryslideshowinfo infoelementdescriptionitemdescriptionfontslideshow normal22px27px helveticaw01boldhelveticaw02boldhelveticaltw10boldsansseriftextdecoration compjx0ufbh5sweet savorygalleryitemwrapper galleryitemgalleryitemvideogaramondserifitemdescriptionfontcolor50pxheight 4pxwidthgalleryitemhover infoelementcustombuttonwrapper100userselectprogalleryinlinestyles galleryitemcontainerprogallerymobileindicator galleryitembottominfostylejx3tvtjrnavcontainerarrowstylejx3tvtjrnavcontainerleftdirection0 transparent 140px1d1b19backgroundcolorrgb107allyourbuttoncompjx1b5lwe profullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestylesif4s ease249 249galleryitemcontainerprogallerymobileindicator galleryitemwrapperstylejx3tvtjrnavcontainersvgcontainer0cursor139 importantcompjx0ufbh5100heightnninfosvgtypeshapeviewbox0eb garamondseriftextdecoration compjx1b5lwefullscreensocialbeachtypemetapropsnamedescriptioncontentla creperiesvg galleryitemsvgforegroundfillrgb249showmorecontainerprogallerymobileindicatorbuttoncompjx0ufbh5blockpadding 0border 0backgroundstylejx3tvtjrnavcontainerleftdirectionantiquapalatino linotypeserifitemfontcolorslideshowgaramondserifcolorrgb249 248 246248 246compjx1b5lwesolid22px27px avenirltw0185heavy1475544sansseriftextdecorationimportant0cursor pointercolor inherittransitionsidewalk seatingstylejx3uiweh musicplayer2534280964trackwrapperhovertwocolorsgalleryitemcontainerprogallerymobileindicatorgalleryitemcontainerprogallerymobileindicator galleryitembottominfobuttoncompjx0ufbh5 progalleryinlinestylespointercolor inherittransition colorbuttonshowmoreloadmorebuttonborderradius 0loadmorebuttonbordercoloroptionprogalleryinlinestyles galleryitemcontainerprogallerymobileindicator galleryitemwrapperall 03sartsyrgba15327 25compjx0ufbh518galleryitemdescriptioncompjx1b5lwe progalleryinlinestyles galleryitemcontainerinherittransition colorgalleryitemhoverbeforeitemopacity f9f8f6backgroundrgba156normal 38px47pxavenirltw0135light1475496sansseriftextdecorationrestaurant longf9f8f6loadmorebuttonborderwidth 1loadmorebuttoncolorbeachpageuriseohomehidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidc1kcbjx19m7fybgmetadatapageidc1kcbispresetfalseschemaversion20ishiddenfalsemediareftypeimageidc1kcbdesktopmediarefmetadatapageidc1kcbispresetfalseschemaversion20ishiddenfalsetitlered satingaramondserifcustombuttonfontcolorforhover f9f8f6colorf9f8f6technicalmusicplayer2534280964trackactions svg gn nninfosvgtypeshapeviewbox0 04pxmargin 0position relativetransitionnormal 40px14emfffbordergalleryslideshowinfo galleryitemtitlecompjx1b5lwergba249 248 246slideshowarrowarrowscolor 1d1b19fillrgb29galleryitemhoverdefaultnothidehoverbeforebackgroundf9f8f6 importantcompjx1b5lweinfoelementtitleitemfontset up yourprofullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestyles fullscreenmobilebarimportantleftauto importantzindex50bba28b stylejx3uiwehmusicplayer2534280964rootmusicplayer2534280964ishoverstategalleryslideshowinfo galleryitemdescriptioncompjx0ufbh5normal 15px14emmarginleft calc100galleryslideshowinfogalleryslideshowinfo infoelementtitleitemfontslideshowgalleryitemcontainerprogallerymobileindicator galleryitemtextsvg pathfill15px14em eb garamondserifitemdescriptionfontcolorslideshowlinotypeserifitemfontcolorslideshow f9f8f6colorrgb249 248twocolors svg g246 importantfontnormalfont0borderselectdatapreviewerror stylejx3tvtjrnavcontainerarrowinfoelementdescriptioncompjx0ufbh5f9f8f6backgroundrgba29 27 25fullscreenviewfullscreenbrightprofullscreeninlinestyles fullscreensidebardescriptionscale3 stylejx3uiwehcalc100 980pxbba28b stylejx3uiwehbuttoncustombuttonfontforhover normalbuttoncompjx1b5lwe profullscreenwrapper100 stylejx3uiwehmusicplayer2534280964trackactions svg4pxmargingalleryslideshowinfo galleryitemdescriptioncompjx1b5lwe40px14em georgiapalatinobookstylejx3tvtjrnavcontainercenterdirectiongalleryitemcontainerprogallerymobileindicator galleryitemwrapper galleryslideshowinfoopacity 4s246compjx1b5lwegalleryitemdescriptioncompjx0ufbh5 progalleryinlinestyles galleryitemcontainerinfoelementdescriptioncompjx1b5lwe progalleryinlinestylesgalleryslideshowinfo acolorrgb249 248normal 15px18px22px14em georgiapalatinobook antiquapalatinogalleryitemcontainerprogallerymobileindicatorinverthovergalleryitembottominfo infoelementcustombuttonwrapperantiquapalatino linotypeseriftextdecoration compjx1b5lwe0background transparentoutline 0cursorbuttoncompjx0ufbh5 progalleryinlinestyles galleryitemcontainerprogallerymobileindicatorcontact usease opacity 4s249 249 1backgroundcolorrgba255fullscreenmobilebargalleryitemdescriptioncompjx1b5lwe progalleryinlinestyles galleryitemcontainerprogallerymobileindicator0borderradius 50pxheight 100userselectartsy french eateryinfoelementcustombuttonwrapper buttoncompjx1b5lwe progalleryinlinestyles25compjx0ufbh5 profullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestylessavory0galleryitemtitlecompjx0ufbh54pxneuediv

Longtail Keyword Density for Lacreperiecafe.net

KeywordsOccurences
pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator gallery-item-wrapper58
normal normal normal58
pro-galleryinline-styles gallery-item-container gallery-item-wrapper58
normal normal 15px14em56
normal 15px14em eb53
importantfontnormal normal normal30
gallery-item-containerpro-gallery-mobile-indicator gallery-item-wrapper gallery-item-hover28
gallery-item-container gallery-item-wrapper gallery-item-hover28
gallery-item-containerpro-gallery-mobile-indicator gallery-item-wrapper gallery-slideshow-info20
gallery-item-container gallery-item-wrapper gallery-slideshow-info20
15px14em eb garamondseriftext-decoration18
248 246 importantfontnormal18
246 importantfontnormal normal18
calc100 980px 0518
margin-left calc100 980px18
normal normal 15px18px15
normal normal 24px14em14
f9f8f6colorrgb249 248 24614
24px14em georgiapalatinobook antiquapalatino13
normal 24px14em georgiapalatinobook13
pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator gallery-item-bottom-info12
pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator gallery-item-top-info12
pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator gallery-slideshow-info12
pro-galleryinline-styles gallery-item-container gallery-slideshow-info12
pro-galleryinline-styles gallery-item-container gallery-item-top-info12
pro-galleryinline-styles gallery-item-container gallery-item-bottom-info12
font normal normal11
french restaurant long10
seating dishing up10
custom-button-wrapper buttoncomp-jx0ufbh5 pro-galleryinline-styles10
creperie cafe french10
creperie cafe artsy10
cafe artsy french10
artsy french eatery10
eatery with sidewalk10
sidewalk seating dishing10
custom-button-wrapper buttoncomp-jx1b5lwe pro-galleryinline-styles10
cafe french restaurant10
normal normal 22px27px10
dishing up sweet10
up sweet savory10
sweet savory crpes10
savory crpes sandwiches10
importantcomp-jx0ufbh5 pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator9
importantcomp-jx1b5lwe pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator9
buttoncomp-jx1b5lwe pro-galleryinline-styles gallery-item-container8
153 150 068
15px14em eb garamondserifcolorrgb2498
27 25 0618
gallery-item-wrapper gallery-slideshow-info svg8
gallery-item-wrapper gallery-item-hover svg8
buttoncomp-jx0ufbh5 pro-galleryinline-styles gallery-item-container8
eb garamondserifcolorrgb249 2488
info-element-title--itemfontslideshow normal normal8
georgiapalatinobook antiquapalatino linotypeserif--itemfontcolorslideshow8
buttoncomp-jx1b5lwe pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator8
linotypeserif--itemfontcolorslideshow f9f8f6colorrgb249 2488
buttoncomp-jx0ufbh5 pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator8
gallery-slideshow-info info-element-title--itemfontslideshow normal8
antiquapalatino linotypeserif--itemfontcolorslideshow f9f8f6colorrgb2498
normal 15px18px avenir-lt-w0135-light1475496sans-seriftext-decoration7
15px18px avenir-lt-w0135-light1475496sans-seriftext-decoration comp-jx1b5lwe7
avenir-lt-w0135-light1475496sans-seriftext-decoration comp-jx1b5lwe pro-galleryinline-styles7
comp-jx1b5lwe pro-galleryinline-styles gallery-item-container7
importantcomp-jx0ufbh5 pro-galleryinline-styles gallery-item-container7
importantcomp-jx1b5lwe pro-galleryinline-styles gallery-item-container7
comp-jx0ufbh5 pro-galleryinline-styles gallery-item-container7
comp-jx1b5lwe pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator7
comp-jx0ufbh5 pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator7
pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles fullscreen-nav6
pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles fullscreen-social6
info-element-custom-button-wrapper buttoncomp-jx1b5lwe pro-galleryinline-styles6
pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles fullscreen-mobile-bar6
248 246fontnormal normal6
pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles fullscreen-side-bar-social6
246fontnormal normal normal6
150 06 importantcomp-jx1b5lwe6
normal normal 22px14em6
info-element-custom-button-wrapper buttoncomp-jx0ufbh5 pro-galleryinline-styles6
061 importantcomp-jx0ufbh5 pro-galleryinline-styles6
25 061 importantcomp-jx0ufbh56
your payment method6
eb garamondseriftext-decoration comp-jx0ufbh56
06 importantcomp-jx1b5lwe pro-galleryinline-styles6
garamondserif--itemdescriptionfontcolorslideshow f9f8f6colorrgb249 2486
eb garamondserif--itemdescriptionfontcolorslideshow f9f8f6colorrgb2496
up your payment6
15px14em eb garamondserif--itemdescriptionfontcolorslideshow6
gallery-item-descriptioncomp-jx1b5lwe pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator5
gallery-item-titlecomp-jx1b5lwe pro-galleryinline-styles gallery-item-container5
long beachtypemetapropsnamedescriptioncontentla creperie5
gallery-item-titlecomp-jx1b5lwe pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator5
gallery-item-titlecomp-jx0ufbh5 pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator5
gallery-item-descriptioncomp-jx1b5lwe pro-galleryinline-styles gallery-item-container5
gallery-item-descriptioncomp-jx0ufbh5 pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator5
color 4s ease5
4s ease style-jx3uiweh5
opacity 4s ease5
ease opacity 4s5
beachtypemetapropsnamedescriptioncontentla creperie cafe5
restaurant long beachtypemetapropsnamedescriptioncontentla5
4s ease opacity5
15px14em eb garamondserif5
georgiapalatinobook antiquapalatino linotypeserif5
normal 15px18px helvetica-w01-lighthelvetica-w02-lightsans-seriftext-decoration5
gallery-item-titlecomp-jx0ufbh5 pro-galleryinline-styles gallery-item-container5
gallery-item-descriptioncomp-jx0ufbh5 pro-galleryinline-styles gallery-item-container5
helvetica-w01-lighthelvetica-w02-lightsans-seriftext-decoration comp-jx0ufbh5 pro-galleryinline-styles5
15px18px helvetica-w01-lighthelvetica-w02-lightsans-seriftext-decoration comp-jx0ufbh55
garamondserifcolorrgb249 248 2464
pro-galleryinline-styles gallery-item-container gallery-item-text4
f9f8f6--itemdescriptionfontslideshow normal normal4
info-element-description--itemdescriptionfontcolorslideshow f9f8f6--itemdescriptionfontslideshow normal4
gallery-slideshow-info info-element-description--itemdescriptionfontcolorslideshow f9f8f6--itemdescriptionfontslideshow4
gallery-slideshow-info info-element-custom-button-wrapper button--custombuttonfontforhover4
eb garamondserif--custombuttonfontcolorforhover f9f8f6colorf9f8f64
22px14em georgiapalatinobook antiquapalatino4
gallery-item-hoverdefaultnothide-hoverbeforebackgroundf9f8f6 importantcomp-jx1b5lwe pro-galleryinline-styles4
info-element-custom-button-wrapper button--custombuttonfontforhover normal4
normal 22px14em georgiapalatinobook4
eb garamondseriftext-decoration comp-jx1b5lwe4
f9f8f6colorf9f8f6 importantfontnormal normal4
garamondserif--custombuttonfontcolorforhover f9f8f6colorf9f8f6 importantfontnormal4
set up your4
15px14em eb garamondserif--custombuttonfontcolorforhover4
button--custombuttonfontforhover normal normal4
sandwiches pastametakeywordsseopagetitleseola creperie4
gallery-item-containerpro-gallery-mobile-indicator gallery-item-wrapper gallery-itemgallery-item-video4
246 importantcomp-jx0ufbh5 pro-galleryinline-styles4
acomp-jx0ufbh5 pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles4
inotpro-gallery-lovedcomp-jx0ufbh5 pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles4
gallery-item-hoverdefaultnothide-hoverbeforebackgroundf9f8f6 importantcomp-jx0ufbh5 pro-galleryinline-styles4
f9f8f6backgroundrgba29 27 254
pastametakeywordsseopagetitleseola creperie cafe4
139 importantcomp-jx0ufbh5 pro-galleryinline-styles4
162 139 importantcomp-jx0ufbh54
gallery-slideshow-info gallery-item-descriptioncomp-jx0ufbh5 pro-galleryinline-styles4
helvetica-w01-boldhelvetica-w02-boldhelvetica-lt-w10-boldsans-seriftext-decoration comp-jx0ufbh5 pro-galleryinline-styles4
22px27px helvetica-w01-boldhelvetica-w02-boldhelvetica-lt-w10-boldsans-seriftext-decoration comp-jx0ufbh54
normal 22px27px helvetica-w01-boldhelvetica-w02-boldhelvetica-lt-w10-boldsans-seriftext-decoration4
gallery-slideshow-info gallery-item-titlecomp-jx0ufbh5 pro-galleryinline-styles4
248 246 importantcomp-jx0ufbh54
texturejpguri4c991a96acd2f5d77f42aebb7e865e1f830f71mv2jpgdescriptionprivatewidth1024height765altartistidnameopacity1colorcolor15aligntypecenterfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimageadvancedseodatatagstypetitlechildrenla creperie cafe4
f9f8f6backgroundrgba156 153 1504
restaurant long beachpageuriseohomehidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidc1kcbjx19m7fybgmetadatapageidc1kcbispresetfalseschemaversion20ishiddenfalsemediareftypeimageidc1kcbdesktopmediarefmetadatapageidc1kcbispresetfalseschemaversion20ishiddenfalsetitlered4
long beachpageuriseohomehidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidc1kcbjx19m7fybgmetadatapageidc1kcbispresetfalseschemaversion20ishiddenfalsemediareftypeimageidc1kcbdesktopmediarefmetadatapageidc1kcbispresetfalseschemaversion20ishiddenfalsetitlered satin4
beachpageuriseohomehidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidc1kcbjx19m7fybgmetadatapageidc1kcbispresetfalseschemaversion20ishiddenfalsemediareftypeimageidc1kcbdesktopmediarefmetadatapageidc1kcbispresetfalseschemaversion20ishiddenfalsetitlered satin texturejpguri4c991a96acd2f5d77f42aebb7e865e1f830f71mv2jpgdescriptionprivatewidth1024height765altartistidnameopacity1colorcolor15aligntypecenterfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewportmobilecustomtruereftypebackgroundmediaidcustombgimgb7vmetadatapageidc1kcbispresetfalseschemaversion20ishiddenfalsemediareftypeimageidc1kcbmobilemediarefmetadatapageidc1kcbispresetfalseschemaversion20ishiddenfalsetitlered4
crpes sandwiches pastametakeywordsseopagetitleseola4
texturejpguri4c991a96acd2f5d77f42aebb7e865e1f830f71mv2jpgdescriptionprivatewidth1024height765altartistidnameopacity1colorcolor15aligntypecenterfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewportmobilecustomtruereftypebackgroundmediaidcustombgimgb7vmetadatapageidc1kcbispresetfalseschemaversion20ishiddenfalsemediareftypeimageidc1kcbmobilemediarefmetadatapageidc1kcbispresetfalseschemaversion20ishiddenfalsetitlered satin texturejpguri4c991a96acd2f5d77f42aebb7e865e1f830f71mv2jpgdescriptionprivatewidth1024height765altartistidnameopacity1colorcolor15aligntypecenterfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimageadvancedseodatatagstypetitlechildrenla4
acomp-jx1b5lwe pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles4
inotpro-gallery-lovedcomp-jx1b5lwe pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles4
pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles fullscreen-side-bar-description4
garamondserifcolorrgb249 248 246fontnormal4
f9f8f6--descriptionfontexpand normal normal4
pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator gallery-item-text4
satin texturejpguri4c991a96acd2f5d77f42aebb7e865e1f830f71mv2jpgdescriptionprivatewidth1024height765altartistidnameopacity1colorcolor15aligntypecenterfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimageadvancedseodatatagstypetitlechildrenla creperie4
satin texturejpguri4c991a96acd2f5d77f42aebb7e865e1f830f71mv2jpgdescriptionprivatewidth1024height765altartistidnameopacity1colorcolor15aligntypecenterfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewportmobilecustomtruereftypebackgroundmediaidcustombgimgb7vmetadatapageidc1kcbispresetfalseschemaversion20ishiddenfalsemediareftypeimageidc1kcbmobilemediarefmetadatapageidc1kcbispresetfalseschemaversion20ishiddenfalsetitlered satin4
gallery-item-hover info-element-custom-button-wrapper--custombuttonfontcolor f9f8f6colorf9f8f64
eb garamondseriftext-decoration background4
gallery-item-hover svg gallery-item-svg-background--itemopacity4
garamondseriftext-decoration backgroundrgb29 274
gallery-item-wrapper gallery-itemload-with-color--imageloadingcolor 1d1b19background-colorrgb1074
gallery-itemload-with-color--imageloadingcolor 1d1b19background-colorrgb107 1044
gallery-item-container gallery-item-wrapper gallery-itemgallery-item-video4
gallery-item-wrapper gallery-itemgallery-item-video igallery-item-video-play-triangle--itemfontcolor4
gallery-item-wrapper gallery-itemgallery-item-video igallery-item-video-play-background--itemopacity4
gallery-item-wrapper gallery-item-hover gradient-top--itemopacity4
09fontnormal normal normal4
0 transparent 140px4
gallery-item-wrapper gallery-slideshow-info acolorrgb2494
gallery-slideshow-info acolorrgb249 2484
acolorrgb249 248 2464
248 246 importantcomp-jx1b5lwe4
246 importantcomp-jx1b5lwe pro-galleryinline-styles4
gallery-slideshow-info svg gallery-item-svg-foregroundfillrgb2494
eb garamondseriftext-decoration backgroundrgb294
15px14em eb garamondserif--loadmorebuttonfontcolor4
gallery-item-svg-foregroundfillrgb249 248 2464
255 1 style-jx3tvtjrnavcontainer4
antiquapalatino linotypeserif colorf9f8f64
border-width2px border-stylesolidborder-colorrgba249 2494
border-stylesolidborder-colorrgba249 249 2494
249 249 1background-colorrgba2554
249 1background-colorrgba255 2554
1background-colorrgba255 255 2554
255 255 14
rgba153 112 744
1d1b19--loadmorebuttonfont normal normal4
112 74 14
74 1 style-jx3uiwehmusicplayer2534280964root4
ishow-morecolorrgba0 0 04
buttonshow-more--loadmorebuttonborderradius 0--loadmorebuttonbordercolor f9f8f6--loadmorebuttonborderwidth4
0--loadmorebuttonbordercolor f9f8f6--loadmorebuttonborderwidth 1--loadmorebuttoncolor4
f9f8f6--loadmorebuttonborderwidth 1--loadmorebuttoncolor 1d1b19--loadmorebuttonfont4
1--loadmorebuttoncolor 1d1b19--loadmorebuttonfont normal4
svg gallery-item-svg-foregroundfillrgb249 2484
slideshow-arrow--arrowscolor 1d1b19fillrgb29 274
gallery-slideshow-info gallery-item-titlecomp-jx1b5lwe pro-galleryinline-styles4
gallery-item-wrapper gallery-item-hover custom-button-wrapper4
info-element-description--itemdescriptionfont normal normal4
15px14em eb garamondserif--itemdescriptionfontcolor4
eb garamondserif--itemdescriptionfontcolor 1d1b19colorrgb294
garamondserif--itemdescriptionfontcolor 1d1b19colorrgb29 274
1d1b19colorrgb29 27 254
27 25 importantfontnormal4
25 importantfontnormal normal4
gallery-item-wrapper gallery-item-hover info-element-custom-button-wrapper--custombuttonfontcolor4
gallery-item-wrapper gallery-item-hover info-element-custom-button-wrapper4
gallery-item-wrapper gallery-item-hover info-element-description--itemdescriptionfont4
gallery-item-hover info-element-custom-button-wrapper button--custombuttonborderradius4
info-element-custom-button-wrapper button--custombuttonborderradius 0--custombuttonborderwidth4
button--custombuttonborderradius 0--custombuttonborderwidth 1--custombuttonbordercolor4
0--custombuttonborderwidth 1--custombuttonbordercolor 1d1b19--custombuttonfont4
1--custombuttonbordercolor 1d1b19--custombuttonfont normal4
1d1b19--custombuttonfont normal normal4
15px14em eb garamondserifcolorf9f8f64
eb garamondserifcolorf9f8f6 importantfontnormal4
garamondserifcolorf9f8f6 importantfontnormal normal4
gallery-item-hover info-element-description--itemdescriptionfont normal4
us to complete4
georgiapalatinobook antiquapalatino linotypeseriftext-decoration4
27 25 importantcomp-jx1b5lwe4
gallery-item-wrapper gallery-slideshow-info info-element-description--itemdescriptionfontslideshow4
gallery-slideshow-info info-element-description--itemdescriptionfontslideshow normal4
gallery-slideshow-info gallery-item-descriptioncomp-jx1b5lwe pro-galleryinline-styles4
avenir-lt-w0185-heavy1475544sans-seriftext-decoration comp-jx1b5lwe pro-galleryinline-styles4
normal 22px27px avenir-lt-w0185-heavy1475544sans-seriftext-decoration4
gallery-item-wrapper gallery-slideshow-info info-element-title--itemfontslideshow4
info-element-description--itemdescriptionfontslideshow normal normal4
22px27px avenir-lt-w0185-heavy1475544sans-seriftext-decoration comp-jx1b5lwe4
25 importantcomp-jx1b5lwe pro-galleryinline-styles4
gallery-item-hover info-element-title--itemfont normal4
info-element-title--itemfont normal normal4
georgiapalatinobook antiquapalatino linotypeserif--itemfontcolor4
gallery-item-wrapper gallery-item-hover info-element-title--itemfont4
hiddenwhite-space nowraptext-overflow ellipsis3
transparentborder 0border-radius 50pxheight3
inherittransition color 4s3
pointercolor inherittransition color3
0cursor pointercolor inherittransition3
transparentoutline 0cursor pointercolor3
0background transparentoutline 0cursor3
0border 0background transparentoutline3
blockpadding 0border 0background3
nowraptext-overflow ellipsis style-jx3uiweh3
normal normal 40px14em3
positionfixed importantleftauto importantz-index503
25comp-jx1b5lwe pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles3
248 246comp-jx1b5lwe pro-fullscreen-wrapper3
comp-jx1b5lwe pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles3
fffborder 0border-radius 50pxheight3
normal 40px14em georgiapalatinobook3
normal 14px14em eb3
normal normal 14px14em3
n nninfosvgtypeshapeviewbox0 03
40px14em georgiapalatinobook antiquapalatino3
n n nninfosvgtypeshapeviewbox03
0border-radius 50pxheight 100user-select3
0position relativetransition all3
0border-radius 50pxheight 4pxwidth3
svg gfill bba28b3
27 25comp-jx1b5lwe pro-galleryinline-styles3
gallery-item-hoverbefore--itemopacity f9f8f6backgroundrgba156 1533
1d1b19colorrgb29 27 25comp-jx1b5lwe3
normal 15px14em quoteb3
buttoncomp-jx1b5lwe pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles3
normal normal 38px47px3
garamondseriftext-decoration comp-jx0ufbh5 pro-galleryinline-styles3
musicplayer2534280964trackactions svg g3
gfill bba28b style-jx3uiweh3
gallery-item-hoverbefore--itemopacity f9f8f6backgroundrgba29 273
g gfill bba28b3
svg g gfill3
svg g pathnth-of-type2fill3
50pxheight 4pxwidth 4pxmargin3
27 25comp-jx1b5lwe pro-fullscreen-wrapper3
246comp-jx1b5lwe pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles3
rgba249 248 2463
relativetransition all 03s3
27 25comp-jx0ufbh5 pro-fullscreen-wrapper3
25comp-jx0ufbh5 pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles3
comp-jx0ufbh5 pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles3
248 246comp-jx0ufbh5 pro-fullscreen-wrapper3
246comp-jx0ufbh5 pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles3
antiquapalatino linotypeseriftext-decoration comp-jx1b5lwe3
4pxmargin 0position relativetransition3
buttoncomp-jx0ufbh5 pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles3
4pxwidth 4pxmargin 0position3
twocolors svg g3
normal normal175
pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator98
pro-galleryinline-styles gallery-item-container98
pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles60
gallery-item-container gallery-item-wrapper58
gallery-item-containerpro-gallery-mobile-indicator gallery-item-wrapper58
gallery-item-wrapper gallery-item-hover56
normal 15px14em56
15px14em eb53
gallery-item-wrapper gallery-slideshow-info40
248 24631
importantfontnormal normal30
georgiapalatinobook antiquapalatino23
importantcomp-jx1b5lwe pro-galleryinline-styles22
importantcomp-jx0ufbh5 pro-galleryinline-styles22
creperie cafe21
27 2518
0 018
eb garamondseriftext-decoration18
980px 0518
f9f8f6colorrgb249 24818
246 importantfontnormal18
calc100 980px18
margin-left calc10018
buttoncomp-jx0ufbh5 pro-galleryinline-styles16
buttoncomp-jx1b5lwe pro-galleryinline-styles16
normal 15px18px15
comp-jx1b5lwe pro-galleryinline-styles14
none style-jx3uiweh14
normal 24px14em14
comp-jx0ufbh5 pro-galleryinline-styles14
24px14em georgiapalatinobook13
gallery-item-containerpro-gallery-mobile-indicator gallery-slideshow-info12
gallery-item-containerpro-gallery-mobile-indicator gallery-item-top-info12
gallery-item-container gallery-slideshow-info12
gallery-item-container gallery-item-top-info12
gallery-item-container gallery-item-bottom-info12
gallery-item-containerpro-gallery-mobile-indicator gallery-item-bottom-info12
font normal11
sweet savory10
gallery-item-descriptioncomp-jx1b5lwe pro-galleryinline-styles10
restaurant long10
up sweet10
gallery-item-titlecomp-jx0ufbh5 pro-galleryinline-styles10
1d1b19colorrgb29 2710
153 15010
gallery-item-descriptioncomp-jx0ufbh5 pro-galleryinline-styles10
french restaurant10
custom-button-wrapper buttoncomp-jx0ufbh510
crpes sandwiches10
gallery-item-titlecomp-jx1b5lwe pro-galleryinline-styles10
normal 22px27px10
cafe french10
cafe artsy10
custom-button-wrapper buttoncomp-jx1b5lwe10
dishing up10
seating dishing10
sidewalk seating10
savory crpes10
artsy french10
4s ease10
french eatery10
bba28b style-jx3uiweh9
svg g9
150 068
info-element-title--itemfontslideshow normal8
25 0618
linotypeserif--itemfontcolorslideshow f9f8f6colorrgb2498
gallery-item-wrapper gallery-itemgallery-item-video8
antiquapalatino linotypeserif--itemfontcolorslideshow8
255 2558
gallery-slideshow-info svg8
gallery-item-hover svg8
gallery-slideshow-info info-element-title--itemfontslideshow8
eb garamondserifcolorrgb2498
garamondserifcolorrgb249 2488
avenir-lt-w0135-light1475496sans-seriftext-decoration comp-jx1b5lwe7
eb garamondserif7
margin0line-heightnormalletter-spacingnormal txtnew7
27 25comp-jx1b5lwe7
15px18px avenir-lt-w0135-light1475496sans-seriftext-decoration7
garamondserif--itemdescriptionfontcolorslideshow f9f8f6colorrgb2496
06 importantcomp-jx1b5lwe6
payment method6
normal 22px14em6
248 246fontnormal6
246fontnormal normal6
fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles fullscreen-side-bar-social6
your payment6
fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles fullscreen-nav6
fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles fullscreen-mobile-bar6
fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles fullscreen-social6
info-element-custom-button-wrapper buttoncomp-jx1b5lwe6
up your6
eb garamondserif--itemdescriptionfontcolorslideshow6
808080 style-jx3uiweh6
gfill bba28b6
ease style-jx3uiweh6
0border-radius 50pxheight6
100 style-jx3uiweh6
garamondseriftext-decoration comp-jx0ufbh56
info-element-custom-button-wrapper buttoncomp-jx0ufbh56
061 importantcomp-jx0ufbh56
color 4s5
antiquapalatino linotypeserif5
15px18px helvetica-w01-lighthelvetica-w02-lightsans-seriftext-decoration5
opacity 4s5
beachtypemetapropsnamedescriptioncontentla creperie5
long beachtypemetapropsnamedescriptioncontentla5
1 style-jx3tvtjrnavcontainer5
helvetica-w01-lighthelvetica-w02-lightsans-seriftext-decoration comp-jx0ufbh55
style-jx3uiweh musicplayer2534280964trackwrapperhover5
svg gfill5
ease opacity5
bba28b style-jx3uiwehmusicplayer2534280964root5
27 25comp-jx0ufbh55
inotpro-gallery-lovedcomp-jx0ufbh5 pro-fullscreen-wrapper4
gallery-item-bottom-info info-element-custom-button-wrapper4
gallery-item-container gallery-item-text4
gallery-item-bottom-info custom-button-wrapper4
acomp-jx0ufbh5 pro-fullscreen-wrapper4
gallery-item-text info-element-custom-button-wrapper4
gallery-item-hoverdefaultforce-hoverbeforecomp-jx0ufbh5 pro-galleryinline-styles4
gallery-item-text custom-button-wrapper4
info-element-descriptioncomp-jx0ufbh5 pro-galleryinline-styles4
info-element-titlecomp-jx0ufbh5 pro-galleryinline-styles4
gallery-item-hoverdefaultnothide-hoverbeforebackgroundf9f8f6 importantcomp-jx0ufbh54
f9f8f6--itemdescriptionfontslideshow normal4
contact us4
technical issue4
garamondseriftext-decoration background4
pro-galleryinline-styles gallery-item-containernotinvert-hover4
f9f8f6backgroundrgba156 1534
gallery-item-hoverdefaultforce-hoverbeforecomp-jx1b5lwe pro-galleryinline-styles4
gallery-item-hoverdefaultnothide-hoverbeforebackgroundf9f8f6 importantcomp-jx1b5lwe4
pro-galleryinline-styles gallery-item-containerinvert-hover4
info-element-titlecomp-jx1b5lwe pro-galleryinline-styles4
gallery-item-top-info info-element-custom-button-wrapper4
accept online4
complete your4
22px14em georgiapalatinobook4
info-element-descriptioncomp-jx1b5lwe pro-galleryinline-styles4
gallery-slideshow-info info-element-description--itemdescriptionfontcolorslideshow4
info-element-description--itemdescriptionfontcolorslideshow f9f8f6--itemdescriptionfontslideshow4
gallery-item-top-info custom-button-wrapper4
set up4
gallery-slideshow-info custom-button-wrapper4
pastametakeywordsseopagetitleseola creperie4
buttonnotpro-gallery-lovednotinfo-element-lovedcomp-jx0ufbh5 pro-galleryinline-styles4
texturejpguri4c991a96acd2f5d77f42aebb7e865e1f830f71mv2jpgdescriptionprivatewidth1024height765altartistidnameopacity1colorcolor15aligntypecenterfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimageadvancedseodatatagstypetitlechildrenla creperie4
satin texturejpguri4c991a96acd2f5d77f42aebb7e865e1f830f71mv2jpgdescriptionprivatewidth1024height765altartistidnameopacity1colorcolor15aligntypecenterfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimageadvancedseodatatagstypetitlechildrenla4
texturejpguri4c991a96acd2f5d77f42aebb7e865e1f830f71mv2jpgdescriptionprivatewidth1024height765altartistidnameopacity1colorcolor15aligntypecenterfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewportmobilecustomtruereftypebackgroundmediaidcustombgimgb7vmetadatapageidc1kcbispresetfalseschemaversion20ishiddenfalsemediareftypeimageidc1kcbmobilemediarefmetadatapageidc1kcbispresetfalseschemaversion20ishiddenfalsetitlered satin4
satin texturejpguri4c991a96acd2f5d77f42aebb7e865e1f830f71mv2jpgdescriptionprivatewidth1024height765altartistidnameopacity1colorcolor15aligntypecenterfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewportmobilecustomtruereftypebackgroundmediaidcustombgimgb7vmetadatapageidc1kcbispresetfalseschemaversion20ishiddenfalsemediareftypeimageidc1kcbmobilemediarefmetadatapageidc1kcbispresetfalseschemaversion20ishiddenfalsetitlered4
inotpro-gallery-lovednotinfo-element-lovedcomp-jx0ufbh5 pro-galleryinline-styles4
gallery-item-containerpro-gallery-mobile-indicator gallery-item-text4
1d1b19background-colorrgb29 274
gallery-slideshow-info gallery-item-titlecomp-jx0ufbh54
beachpageuriseohomehidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidc1kcbjx19m7fybgmetadatapageidc1kcbispresetfalseschemaversion20ishiddenfalsemediareftypeimageidc1kcbdesktopmediarefmetadatapageidc1kcbispresetfalseschemaversion20ishiddenfalsetitlered satin4
f9f8f6--descriptionfontexpand normal4
long beachpageuriseohomehidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidc1kcbjx19m7fybgmetadatapageidc1kcbispresetfalseschemaversion20ishiddenfalsemediareftypeimageidc1kcbdesktopmediarefmetadatapageidc1kcbispresetfalseschemaversion20ishiddenfalsetitlered4
fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles fullscreen-side-bar-description4
1d1b19colorrgb245 2374
inotpro-gallery-lovedcomp-jx1b5lwe pro-fullscreen-wrapper4
acomp-jx1b5lwe pro-fullscreen-wrapper4
246 importantcomp-jx0ufbh54
your item4
gallery-slideshow-info info-element-custom-button-wrapper4
f9f8f6backgroundrgba29 274
info-element-custom-button-wrapper button--custombuttonfontforhover4
button--custombuttonfontforhover normal4
eb garamondserif--custombuttonfontcolorforhover4
garamondserif--custombuttonfontcolorforhover f9f8f6colorf9f8f64
eb garamondserifcolorf9f8f64
f9f8f6colorf9f8f6 importantfontnormal4
garamondseriftext-decoration comp-jx1b5lwe4
139 importantcomp-jx0ufbh54
your visitors4
162 1394
sandwiches pastametakeywordsseopagetitleseola4
gallery-slideshow-info gallery-item-descriptioncomp-jx0ufbh54
pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicatornotinvert-hover4
helvetica-w01-boldhelvetica-w02-boldhelvetica-lt-w10-boldsans-seriftext-decoration comp-jx0ufbh54
pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicatorinvert-hover4
22px27px helvetica-w01-boldhelvetica-w02-boldhelvetica-lt-w10-boldsans-seriftext-decoration4
garamondserifcolorf9f8f6 importantfontnormal4
gallery-item-wrapper gallery-item-hover--itemiconcolor4
1d1b19--custombuttonfont normal4
09fontnormal normal4
buttonshow-more--loadmorebuttonborderradius 0--loadmorebuttonbordercolor4
0--loadmorebuttonbordercolor f9f8f6--loadmorebuttonborderwidth4
f9f8f6--loadmorebuttonborderwidth 1--loadmorebuttoncolor4
1--loadmorebuttoncolor 1d1b19--loadmorebuttonfont4
1d1b19--loadmorebuttonfont normal4
eb garamondserif--loadmorebuttonfontcolor4
garamondseriftext-decoration backgroundrgb294
divpro-gallery-parent-container show-more-container4
backgroundrgb29 274
divpro-gallery-parent-container show-more-containerpro-gallery-mobile-indicator4
slideshow-arrow--arrowscolor 1d1b19fillrgb294
1d1b19fillrgb29 274
gallery-item-wrapper gallery-itemload-with-color--imageloadingcolor4
gallery-itemload-with-color--imageloadingcolor 1d1b19background-colorrgb1074
1d1b19background-colorrgb107 1044
ishow-morecolorrgba0 04
style-jx3uiweh musicplayer2534280964active4
gallery-itemgallery-item-video igallery-item-video-play-background--itemopacity4
txtnew ul4
linotypeserif colorf9f8f64
border-width2px border-stylesolidborder-colorrgba2494
border-stylesolidborder-colorrgba249 2494
249 2494
249 1background-colorrgba2554
1background-colorrgba255 2554
255 14
0 style-jx3uiweh4
1--custombuttonbordercolor 1d1b19--custombuttonfont4
50px style-jx3uiweh4
f9f8f6 style-jx3uiweh4
bba28b style-jx3uiwehmusicplayer2534280964rootmusicplayer2534280964--ishoverstate4
rgba153 1124
112 744
74 14
1 style-jx3uiwehmusicplayer2534280964root4
gallery-itemgallery-item-video igallery-item-video-play-triangle--itemfontcolor4
art store4
svg gallery-item-svg-background--itemopacity4
antiquapalatino linotypeseriftext-decoration4
info-element-description--itemdescriptionfontslideshow normal4
25 importantcomp-jx1b5lwe4
info-element-custom-button-wrapper button--custombuttonborderradius4
gallery-item-hover info-element-custom-button-wrapper4
gallery-item-hover info-element-title--itemfont4
info-element-title--itemfont normal4
antiquapalatino linotypeserif--itemfontcolor4
gallery-item-hover info-element-description--itemdescriptionfont4
gallery-slideshow-info gallery-item-descriptioncomp-jx1b5lwe4
info-element-description--itemdescriptionfont normal4
eb garamondserif--itemdescriptionfontcolor4
gallery-item-hover custom-button-wrapper4
info-element-custom-button-wrapper--custombuttonfontcolor f9f8f6colorf9f8f64
gallery-item-hover info-element-custom-button-wrapper--custombuttonfontcolor4
gallery-item-hover gradient-top--itemopacity4
25 importantfontnormal4
gallery-slideshow-info info-element-description--itemdescriptionfontslideshow4
button--custombuttonborderradius 0--custombuttonborderwidth4
avenir-lt-w0185-heavy1475544sans-seriftext-decoration comp-jx1b5lwe4
246 importantcomp-jx1b5lwe4
0 transparent4
transparent 140px4
gallery-item-wrapper gallery-slideshow-info--itemiconcolorslideshow4
0--custombuttonborderwidth 1--custombuttonbordercolor4
inotpro-gallery-lovednotinfo-element-lovedcomp-jx1b5lwe pro-galleryinline-styles4
buttonnotpro-gallery-lovednotinfo-element-lovedcomp-jx1b5lwe pro-galleryinline-styles4
gallery-slideshow-info acolorrgb2494
acolorrgb249 2484
gallery-item-svg-foregroundfillrgb249 2484
svg gallery-item-svg-foregroundfillrgb2494
gallery-slideshow-info gallery-item-titlecomp-jx1b5lwe4
22px27px avenir-lt-w0185-heavy1475544sans-seriftext-decoration4
garamondserif--itemdescriptionfontcolor 1d1b19colorrgb294
0background transparentoutline3
hiddenwhite-space nowraptext-overflow3
ellipsis style-jx3uiweh3
helvetica arial3
0border 0background3
ol ul3
blockpadding 0border3
transparentoutline 0cursor3
nowraptext-overflow ellipsis3
ultxtnew ol3
importantleftauto importantz-index503
nninfosvgtypeshapeviewbox0 03
positionfixed importantleftauto3
04s ease3
selectdata-previewerror style-jx3tvtjrnavcontainerarrow3
style-jx3tvtjrnavcontainerarrow style-jx3tvtjrnavcontainersvgcontainer3
204 2043
n n3
n nninfosvgtypeshapeviewbox03
pointercolor inherittransition3
gallery-item-hoverbefore--itemopacity f9f8f6backgroundrgba1563
color f9f8f63
14px14em eb3
normal 14px14em3
40px14em georgiapalatinobook3
normal 40px14em3
0cursor pointercolor3
all 03s3
inherittransition color3
musicplayer2534280964trackactions svg3
style-jx3uiweh musicplayer2534280964title3
svg pathfill3
linotypeseriftext-decoration comp-jx1b5lwe3
twocolors svg3
18px style-jx3uiweh3
g gfill3
15px14em quoteb3
center style-jx3uiweh3
buttoncomp-jx1b5lwe pro-fullscreen-wrapper3
246comp-jx1b5lwe pro-fullscreen-wrapper3
248 246comp-jx1b5lwe3
comp-jx1b5lwe pro-fullscreen-wrapper3
25comp-jx1b5lwe pro-fullscreen-wrapper3
25comp-jx1b5lwe pro-galleryinline-styles3
rgba249 2483
scale3 style-jx3uiweh3
transparentborder 0border-radius3
25comp-jx0ufbh5 pro-fullscreen-wrapper3
buttoncomp-jx0ufbh5 pro-fullscreen-wrapper3
50pxheight 100user-select3
fffborder 0border-radius3
246comp-jx0ufbh5 pro-fullscreen-wrapper3
248 246comp-jx0ufbh53
comp-jx0ufbh5 pro-fullscreen-wrapper3
50pxheight 4pxwidth3
normal 38px47px3
4pxwidth 4pxmargin3
4pxmargin 0position3
0position relativetransition3
relativetransition all3
gallery-item-hoverbefore--itemopacity f9f8f6backgroundrgba293
0width 100height3
currentcolortransition color3
g pathnth-of-type2fill3
normal292
pro-galleryinline-styles222
gallery-item-wrapper116
gallery-item-container99
gallery-item-containerpro-gallery-mobile-indicator98
style-jx3uiweh91
066
pro-fullscreen-wrapper64
gallery-slideshow-info64
fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles60
eb57
gallery-item-hover56
15px14em56
149
color44
your42
238
svg36
background-color36
creperie33
331
importantfontnormal30
gallery-item-top-info24
gallery-item-bottom-info24
antiquapalatino23
georgiapalatinobook23
importantcomp-jx0ufbh522
importantcomp-jx1b5lwe22
cafe21
comp-jx0ufbh520
french20
bba28b20
comp-jx1b5lwe20
custom-button-wrapper20
info-element-custom-button-wrapper20
buttoncomp-jx1b5lwe19
buttoncomp-jx0ufbh519
0518
garamondseriftext-decoration18
980px18
418
up18
f9f8f6colorrgb24918
calc10018
margin-left18
txtnew18
516
616
15px18px15
ease14
24px14em14
none14
style-jx3tvtjrnavcontainer13
style-jx3uiwehmusicplayer2534280964root13
positionabsolutetop0right0bottom0left013
long12
style-jx3tvtjrnavcontainerarrow11
font11
ul10
sidewalk10
restaurant10
divpro-gallery-parent-container10
710
4s10
payment10
1d1b19colorrgb2910
gallery-item-titlecomp-jx1b5lwe10
810
gallery-item-descriptioncomp-jx1b5lwe10
artsy10
gallery-item-descriptioncomp-jx0ufbh510
gallery-item-titlecomp-jx0ufbh510
seating10
dishing10
sweet10
sandwiches10
savory10
22px27px10
eatery10
crpes10
069
99
g9
109
100height8
store8
gallery-itemgallery-item-video8
50pxheight8
0border-radius8
f9f8f6colorf9f8f68
gallery-item-hoverdefaultnothide-hoverbeforebackgroundf9f8f68
gallery-item-text8
linotypeserif--itemfontcolorslideshow8
118
gfill8
0618
info-element-title--itemfontslideshow8
satin8
garamondserifcolorrgb2498
25comp-jx1b5lwe7
avenir-lt-w0135-light1475496sans-seriftext-decoration7
var7
0border7
margin0line-heightnormalletter-spacingnormal7
ol7
important7
garamondserif7
object6
fullscreen-mobile-bar6
garamondserif--itemdescriptionfontcolorslideshow6
style-jx3tvtjrnavcontainerarrowstyle-jx3tvtjrnavcontainercenter-direction6
style-jx3tvtjrnavcontainerarrowstyle-jx3tvtjrnavcontainerright-direction6
style-jx3tvtjrnavcontainerarrowstyle-jx3tvtjrnavcontainerleft-direction6
246fontnormal6
fullscreen-side-bar-social6
fullscreen-nav6
126
fullscreen-social6
musicplayer2534280964active6
22px14em6
f9f8f66
colorf9f8f66
n6
get6
you6
visitors6
art6
method6
click6
online6
musicplayer2534280964trackwrapperhover6
gallery-item-hoverbefore--itemopacity6
style-jx3uiwehmusicplayer2534280964rootmusicplayer2534280964--ishoverstate6
opacity6
contact5
helvetica-w01-lighthelvetica-w02-lightsans-seriftext-decoration5
25comp-jx0ufbh55
6px5
helvetica5
center5
beachtypemetapropsnamedescriptioncontentla5
linotypeserif5
new5
us5
ultxtnew5
niconnefantasy5
transparent5
musicplayer2534280964trackactions5
12px5
pointercolor5
if5
item4
garamondserif--custombuttonfontcolorforhover4
gallery-item-containerpro-gallery-mobile-indicatornotinvert-hover4
gallery-item-containerpro-gallery-mobile-indicatorinvert-hover4
button--custombuttonfontforhover4
preview4
catchy4
info-element-titlecomp-jx1b5lwe4
f9f8f6--itemdescriptionfontslideshow4
image4
button--custombuttonborderradius4
0--custombuttonborderwidth4
1--custombuttonbordercolor4
1d1b19--custombuttonfont4
garamondserifcolorf9f8f64
background4
gallery-item-containernotinvert-hover4
f9f8f6backgroundrgba1564
info-element-description--itemdescriptionfontcolorslideshow4
gallery-item-hoverdefaultforce-hoverbeforecomp-jx1b5lwe4
story4
gallery-item-containerinvert-hover4
can4
50px4
0width4
info-element-descriptioncomp-jx1b5lwe4
1d1b19background-colorrgb294
acomp-jx1b5lwe4
f9f8f6--descriptionfontexpand4
134
ffffff4
144
b0b0b04
colorbba28b4
pastametakeywordsseopagetitleseola4
acomp-jx0ufbh54
inotpro-gallery-lovedcomp-jx0ufbh54
info-element-descriptioncomp-jx0ufbh54
info-element-titlecomp-jx0ufbh54
gallery-item-hoverdefaultforce-hoverbeforecomp-jx0ufbh54
f9f8f6backgroundrgba294
beachpageuriseohomehidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidc1kcbjx19m7fybgmetadatapageidc1kcbispresetfalseschemaversion20ishiddenfalsemediareftypeimageidc1kcbdesktopmediarefmetadatapageidc1kcbispresetfalseschemaversion20ishiddenfalsetitlered4
154
helvetica-w01-boldhelvetica-w02-boldhelvetica-lt-w10-boldsans-seriftext-decoration4
manage4
border-width2px4
buttonnotpro-gallery-lovednotinfo-element-lovedcomp-jx0ufbh54
inotpro-gallery-lovednotinfo-element-lovedcomp-jx0ufbh54
border-stylesolidborder-colorrgba2494
1background-colorrgba2554
164
1d1b19colorrgb2454
texturejpguri4c991a96acd2f5d77f42aebb7e865e1f830f71mv2jpgdescriptionprivatewidth1024height765altartistidnameopacity1colorcolor15aligntypecenterfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewportmobilecustomtruereftypebackgroundmediaidcustombgimgb7vmetadatapageidc1kcbispresetfalseschemaversion20ishiddenfalsemediareftypeimageidc1kcbmobilemediarefmetadatapageidc1kcbispresetfalseschemaversion20ishiddenfalsetitlered4
texturejpguri4c991a96acd2f5d77f42aebb7e865e1f830f71mv2jpgdescriptionprivatewidth1024height765altartistidnameopacity1colorcolor15aligntypecenterfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimageadvancedseodatatagstypetitlechildrenla4
inotpro-gallery-lovedcomp-jx1b5lwe4
adding4
media4
fullscreen-side-bar-description4
style4
4pxmargin4
0000004
0--loadmorebuttonbordercolor4
false4
neue4
pathnth-of-type2fill4
1d1b19fillrgb294
slideshow-arrow--arrowscolor4
show-more-containerpro-gallery-mobile-indicator4
customers4
backgroundrgb294
not4
09fontnormal4
garamondserif--loadmorebuttonfontcolor4
1d1b19--loadmorebuttonfont4
1--loadmorebuttoncolor4
f9f8f6--loadmorebuttonborderwidth4
buttonshow-more--loadmorebuttonborderradius4
business4
wix4
174
server4
184
but4
lb1itemscontainer4
try4
issue4
ishow-morecolorrgba04
rgba1534
fff4
technical4
blockpadding4
able4
show-more-container4
accept4
pathfill4
gallery-itemload-with-color--imageloadingcolor4
info-element-description--itemdescriptionfontslideshow4
acolorrgb2494
gallery-item-svg-foregroundfillrgb2494
go4
set4
style-jx3tvtjrrepeaterbuttonlabel4
avenir-lt-w0185-heavy1475544sans-seriftext-decoration4
div4
gallery-item-hover--itemiconcolor4
1d1b19background-colorrgb1074
purchase4
info-element-title--itemfont4
linotypeserif--itemfontcolor4
linotypeseriftext-decoration4
info-element-description--itemdescriptionfont4
garamondserif--itemdescriptionfontcolor4
info-element-custom-button-wrapper--custombuttonfontcolor4
buttonnotpro-gallery-lovednotinfo-element-lovedcomp-jx1b5lwe4
inotpro-gallery-lovednotinfo-element-lovedcomp-jx1b5lwe4
igallery-item-video-play-background--itemopacity4
194
140px4
gradient-top--itemopacity4
gallery-item-svg-background--itemopacity4
03s4
items4
complete4
204
gallery-slideshow-info--itemiconcolorslideshow4
images4
igallery-item-video-play-triangle--itemfontcolor4
open4
absolutetop3
nninfosvgtypeshapeviewbox03
currentcolortransition3
currentcolorborder-radius3
all3
40px14em3
4pxwidth3
inherittransition3
14px14em3
playpausebtnmusicplayer2534280964disabled3
style-jx3tvtjrnavcontainercenter-direction3
24px3
04s3
positionfixed3
importantleftauto3
importantz-index503
topautobottom03
style-jx0zwoi6bg3
solid3
213
oldirrtl3
style-jx3tvtjrnavcontainerright-direction3
arial3
hiddenwhite-space3
nowraptext-overflow3
ellipsis3
blockwidth3
0background3
transparentoutline3
0cursor3
musicplayer2534280964trackactionsdisplay3
18px3
style-jx3uiwehmusicplayer2534280964rootmusicplayer2534280964--hassinglerow3
selectdata-previewerror3
scale33
100user-select3
223
4px3
246comp-jx0ufbh53
38px47px3
inset3
flexjustify-content3
option3
quoteb3
rgba2493
fffborder3
musicplayer2534280964title3
relativetransition3
246comp-jx1b5lwe3
transparentborder3
style-jx3tvtjrnavcontainersvgcontainer3
style-jx3tvtjrnavcontainerleft-direction3
twocolors3
selecthover3
selectdata-previewhover3
selectfocus3
selectdata-previewfocus3
selectdata-errortrue3
0position3

Lacreperiecafe.net Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Lacreperiecafe.net is a scam?

Websites with Similar Names

Lacre.net
Untitled Document
Lacreate.org
L.A. create
Lacreatech.com
Félicitations ! Votre domaine a bien été créé chez OVH !
Lacreationdesiteinternet.com
lacreationdesiteinternet.com - Registered at Namecheap.com
Lacreationdesiteweb.com
lacreationdesiteweb.com - Registered at Namecheap.com
Lacreationdesociete.com
Félicitations ! Votre domaine a bien été créé chez OVH !
Lacreations-ms.com
L. A. Creations — Coming Soon
Lacreativablog.com
Runtime Error

Recently Updated Websites

Arc-counseling.com 1 second ago.Askmelogic.com 2 seconds ago.Rapidlms.com 2 seconds ago.Roveraccessories.com 2 seconds ago.Littlebookworms.net 3 seconds ago.Lungdirect.com 3 seconds ago.Escendency.com 3 seconds ago.Soundcardpacket.org 4 seconds ago.Capexfi.com 5 seconds ago.Simplesuppliers.com 5 seconds ago.Bellheatingandairconditioning.com 6 seconds ago.Avloop.com 6 seconds ago.Ecologic-llc.com 6 seconds ago.Soro.xyz 8 seconds ago.Recetadegazpacho.com 8 seconds ago.Chinamotorexpo.com 8 seconds ago.69mr.com 9 seconds ago.Lampotukku.net 9 seconds ago.Viviandelacruz.info 9 seconds ago.Breakviewheatingandair.com 9 seconds ago.Construction57.com 10 seconds ago.Everrist.com 11 seconds ago.Infomanado.net 12 seconds ago.Gaterepairbeverlyhillsca.com 13 seconds ago.Smeserver.com 13 seconds ago.Newstime.in 13 seconds ago.Shangguliyi.com 13 seconds ago.Debiesceramics.com 14 seconds ago.Catbiography.com 14 seconds ago.2020connect.net 14 seconds ago.