La Raza Community Resource Center — Secure

Safety: Low trust score
Year Founded: 2004
Global Traffic Rank: Unknown
Estimated Worth: $9
Category: This site has not been categorized yet



Domain summary

Last updated
2020-11-01
Domain label
larazacrc
Domain extension
org
Domain registered:
2004-07-05
Domain updated:
2020-11-01
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is larazacrc.org ranked relative to other sites:

Percentage of visits to larazacrc.org from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Larazacrc.org registered?
A: Larazacrc.org was registered 16 years, 9 months, 2 weeks, 2 days, 7 hours, 18 minutes, 36 seconds ago on Monday, July 5, 2004.
Q: When was the WHOIS for Larazacrc.org last updated?
A: The WHOIS entry was last updated 5 months, 2 weeks, 6 days, 7 hours, 18 minutes, 36 seconds ago on Sunday, November 1, 2020.
Q: What are Larazacrc.org's nameservers?
A: DNS for Larazacrc.org is provided by the following nameservers:
  • ns1.okapi.arvixe.com
  • ns2.okapi.arvixe.com
Q: Who is the registrar for the Larazacrc.org domain?
A: The domain has been registered at Public Interest Registry.
Q: What is the traffic rank for Larazacrc.org?
A: Larazacrc.org has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Larazacrc.org each day?
A: Larazacrc.org receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Larazacrc.org resolve to?
A: Larazacrc.org resolves to the IPv4 address 198.185.159.144.
Q: In what country are Larazacrc.org servers located in?
A: Larazacrc.org has servers located in the United States.
Q: What webserver software does Larazacrc.org use?
A: Larazacrc.org is powered by Squarespace webserver.
Q: Who hosts Larazacrc.org?
A: Larazacrc.org is hosted by Squarespace, Inc. in New York, New York, United States, 10013.
Q: How much is Larazacrc.org worth?
A: Larazacrc.org has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Larazacrc.org Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Larazacrc.org Free SEO Report

Website Inpage Analysis for Larazacrc.org

H1 Headings

1 :
  1. Under Construction

H2 Headings

0 :

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

3 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

0:

Links - Internal (nofollow)

0:

Links - Outbound

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Larazacrc.org

easeinoutmoztransitioncolorflickrsqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabled dataslicetypebodyusemaskfill222sqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstylesolidsocialiconssizelargesocialiconsstyleknockout170ms easeinoutmoztransitionbackgroundcolordataslicetypesocialicons mediumdataslicetypesocialiconshover facebookhoverbandsintowndataslicetypesocialiconshover spotifyeasesqsslidewrapperdataslidetypelockscreeninputtypesubmitsqsslidewrapperdataslidetypelockscreensqsslidecontainerdataslidetypepopupoverlaynewsletterstylerectangleeaseinoutmoztransitionbackgroundcolor 170ms easeinoutmstransitionbackgroundcolorul lisqsslidewrapperdataslidetypelockscreendataslicetypebuttons lisqsslidewrapperdataslidetypelockscreensocialiconssizesmallsocialiconsstylebordervine2s easeintransitionopacitycodepenhoversqsalbumminimal dataslicetypealbum sqsslicealbumplaylistdataslicetypealbum sqsslicealbumplayliststackedtwitterhovericonwrappersqsslidewrapperdataslidetypelockscreensocialiconsstyleborder dataslicetypesocialicons8pxuseiconfillff0031sqsslidewrapperdataslidetypelockscreendataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypelockscreen socialiconssizeextralargesocialiconsstyleknockoutpasswordstyleunderlinedyoutubehover2spasswordstylerectangle dataslicetypepassworddataslicetypesocialiconshover meetuphoversqsslidecontainerdataslidetypepopupoverlayoverlayalignmentcentertumblrhoversocialiconssizesmallsocialiconsstyleknockoutuseiconfillrgba3434344sqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstyleregulariconwrapperdataslicetypesocialiconshover fivehundredpixhover5px2s easeinotransitionopacitysqsslidewrapperdataslidetypelockscreentweetbody0sqsslidewrapperdataslidetypelockscreenspotifydataslicetypesocialiconshoversocialiconsstylebordericonwrappersqsslidewrapperdataslidetypelockscreen socialiconssizelargesocialiconsstyleknockoutdataslicetypesocialicons usemaskfilltransparentsqsslidewrapperdataslidetypelockscreendataslicetypealbum trackprogressbaruseiconfill0063dcsqsslidewrapperdataslidetypelockscreensocialstacked dataslicetypesocialiconssocialstackedtextalignleft dataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypelockscreen0px 0pxuseiconfilltransparentsqsslidewrapperdataslidetypelockscreensocialiconsstylesolidaudioplayericonsstyleknockout3pxiconwrappersqsslidewrapperdataslidetypelockscreen socialiconssizemediumsocialiconsstylesolidsqssliceplaybuttoniconwrappersqsslidewrapperdataslidetypelockscreeneaseinoutsqsslidewrapperdataslidetypelockscreen socialiconsstylesoliduseiconfill382110sqsslidewrapperdataslidetypelockscreendataslicetypesocialiconshover googleuseiconfillfffsqsslidewrapperdataslidetypelockscreendataslicetypesocialiconshover stumbleupondataslicetypesocialiconshover fivehundredpix170ms easeinoutotransitionbackgroundcolor 170msdataslicetypesocialicons dropboxsocialstacked dataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypelockscreensqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinline actionsstackedcaptchacontainerwrapperlisqsslidewrapperdataslidetypelockscreendataslicetypesocialiconshover vimeodatacompoundtypepopupoverlayaction buttontypesubmitsqsslidewrapperdataslidetypelockscreenvevosqssliceplaybuttoniconwrapperaudioplayericonsstyleborder dataslicetypealbumdataslicetypealbumhover iconwrapperhoverpinterestsvgsocialbackgroundcolor222sqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstyleregular dataslicetypesocialiconsdataslicetypesocialicons twitchdataslicetypesocialiconshover instagramdataslicetypesocialiconshover linkedindataslicetypesocialicons tumblrbuttonstyleoutlinesqsmodallightboxsqsslidecontainerdataslidetypepopupoverlaybuttonlayoutstyleautouseiconfill1ab7easqsslidewrapperdataslidetypelockscreendataslicetypesocialicons yelpdataslicetypesocialiconshover goodreadsdataslicetypesocialiconshover ituneshoversocialiconscolorstandardsocialiconsstyleregular dataslicetypesocialiconsyelpdataslicetypesocialiconshover googleplaydataslicetypebuttons ulstacked6pxyoutube5emfont14pxeaseinout bordercolordataslicetypebody psvgsocialbackgroundcolor222sqsslidewrapperdataslidetypelockscreenlockstylesolid dataslicetypelocksocialiconssizeextrasmallsocialiconsstyleknockoutdataslicetypesocialicons redditshowtracktitlegmstylecciconwrappersqsslidewrapperdataslidetypelockscreen socialiconssizesmallsocialiconsstyleknockoutsocialstackedtextalignleft dataslicetypesocialiconsdataslicetypesocialiconshover behanceeaseinoutmstransitionbackgroundcolor 170mstrackprogressbar2s easeinmoztransitionopacityuseiconfill222sqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstyleregular dataslicetypesocialiconshoverdatacompoundtypepopupoverlayaction170ms easeinoutmstransitionbackgroundcolor170ms easeinoutsqsslidewrapperdataslidetypelockscreendataslicetypesocialiconshover squarespaceiconwrapperwidth24pxheight24pxmargin0spotifyhoverrdiodataslicetypesocialicons tidalsqsslidecontainerdataslidetypepopupoverlaybuttonlayoutstyleinlineasqsslidewrapperdataslidetypelockscreen dataslicetypetwitterusemaskfilltransparentsqsslidewrapperdataslidetypelockscreendataslicetypesocialiconshover rdiodataslicetypepassword inputtypepasswordsqsslidewrapperdataslidetypelockscreendataslicetypesocialiconshover youtubeeaseinoutotransitioncolortidaliconwrappersqsslidewrapperdataslidetypelockscreen socialiconssizelargesocialiconsstylesoliduseiconfillrgba2552552554sqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstylesolideaseinouttransitionbackgroundcolorsqsslicealbumplaylist tracks trackresponsivewrappernotstackedhouzzhoverdataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypelockscreen socialiconssizesmallsocialiconsstyleknockout0ms 0mssquarespacehoversqsslidecontainerdataslidetypepopupoverlaylockstyleregular dataslicetypelockdataslicetypesocialicons goodreadsiconwrapperlastchildmarginright0sqsslidewrapperdataslidetypelockscreensocialiconsstyleregularbuttonsqsslidewrapperdataslidetypelockscreen sqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinline actionsstackederrormessagesqsslidewrapperdataslidetypelockscreenresponsivewrapperstacked dataslicetypenavigation uldataslicetypesocialiconshover mediumiconwrappersqsslidewrapperdataslidetypelockscreen socialiconssizeextrasmallsocialiconsstyleknockoutsqsmodallightboxshowtracktitle sqsalbumminimal dataslicetypealbumfivehundredpixhoverp asqsslidewrapperdataslidetypelockscreenformwrapper inputtypesubmitsqsslidewrapperdataslidetypelockscreendataslicetypesocialiconshover vscogoogleplayhoverdataslicetypesocialiconshover iconwrapperli asqsslidewrapperdataslidetypelockscreensvgsocialwebkittransitionbackgroundcolorresponsivewrapperstacked dataslicetypebuttons ul4pxsocialiconssizesmallsocialiconsstylesolidbehancehoverdataslicetypebuttonssqsslidewrapperdataslidetypelockscreenp ahoversqsslidewrapperdataslidetypelockscreendataslicetypesocialiconshover rsshovericonwrappersqsslidewrapperdataslidetypelockscreen socialiconssizeextrasmallsocialiconsstylesolidul li asqsslidewrapperdataslidetypelockscreenresponsivewrapperstacked dataslicetypenavigationbuttonstyleoutline dataslicetypebuttonssqsalbumminimal dataslicetypealbum sqsslicealbumplayliststackeddataslicetypesocialiconshover pinteresthoverimportantsqsslidewrapperdataslidetypelockscreen sqsslidecontainernotautoimagebackgroundcolorvimeohoverdataslicetypelock usebackgroundfilltransparentsqsslidewrapperdataslidetypelockscreengooglehoverdataslicetypesocialiconshover googleplayhoverinputwrappernothiddensocialiconssizelargesocialiconsstyleregulartwitterthedotshoverautosqsslidewrapperdataslidetypelockscreenimportantsqsslidewrapperdataslidetypelockscreendropboxuseiconfill0099e5sqsslidewrapperdataslidetypelockscreendataslicetypealbumhover iconwrapperulsqsslidewrapperdataslidetypelockscreendataslicetypesocialicons pinterestsqsslidecontainerdataslidetypepopupoverlayenableoverlaycontentbordersmugmughoverdataslicetypenavigationdataslicetypesocialiconshover flickrsoundcloud01sfoursquaredataslicetypegallery galleryvideobackgroundmobiledataslicetypesocialicons foursquaresqsmodallightboxcontentdataslicetypesocialiconshover snapchathoverdataslicetypelockaudioplayericonsstyleregulardataslicetypetwitter tweetavatardataslicetypesocialiconshover tidalhoverdataslicetypecountdown countdowncontentdataformatnumericdataslicetypesocialicons vevoactionssqsslidewrapperdataslidetypelockscreenuseiconfill000sqsslidewrapperdataslidetypelockscreendataslicetypegallerypasswordstyleunderlined dataslicetypepasswordsocialiconsstylesolid dataslicetypesocialiconshoverdataslicetypesocialiconshover rssapplepodcasthoveruseiconfille0393esqsslidewrapperdataslidetypelockscreendataslicetypecountdown countdowncontentdataformattextual countdownunitsocialiconssizemediumsocialiconsstylesoliddataslicetypesocialiconshover smugmughoverbuttonsqsslidewrapperdataslidetypelockscreen sqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinlineuseiconfillae995asqsslidewrapperdataslidetypelockscreendataslicetypealbum iconwrapperlastchildmarginright0sqsslidewrapperdataslidetypelockscreeneaseinouttransitionbackgroundcolor 170ms easeinoutsqsslidewrapperdataslidetypelockscreendataslicetypesocialiconshover thedotsfoursquarehoversocialstackeddataslicetypesocialiconshover vevohoverdataslicetypesocialiconshover behancehoverlightboxcontent formwrapperdataslicetypenavigation ul litweetdisplaynamesqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabledbuttonstyleraiseddataslicetypesocialiconshover foursquaredataslicetypesocialiconshover applepodcasthoverdataslicetypesocialicons meetupavisitedsqsslidewrapperdataslidetypelockscreendataslicetypesocialiconshover spotifyhoversvgsocialbackgroundcolor222sqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconshoverall and maxwidth600pxsqsslidewrapperdataslidetypelockscreenstumbleuponvideoiconstyleregulardataslicetypetwitternotdatacompoundtype tweetbodyinputtypesubmitsqsslidewrapperdataslidetypelockscreen buttonstyleoutlineuseiconfill00ab6csqsslidewrapperdataslidetypelockscreenmediumdataslicetypesocialiconshover bandsintownhoversqsslicecustomformuseiconfillc41200sqsslidewrapperdataslidetypelockscreendataslicetypeheadingnotdatacompoundtypesvgsocialbackgroundcolorrgba3434344sqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstylesoliddataslicetypesocialiconshover itunesdataslicetypesocialiconshover googlehoverdataslicetypesocialiconshover twittereaseoutopacitytumblrdataslicetypesocialicons youtubebordercolor 170ms easeinoutsqsslidewrapperdataslidetypelockscreenvevohoverlockstyleregularsocialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconsusemaskfillrgba3434344sqsslidewrapperdataslidetypelockscreensocialiconsstyleknockout dataslicetypesocialiconsuseiconfill222sqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstyleborder dataslicetypesocialiconsuseiconfillf94877sqsslidewrapperdataslidetypelockscreendataslicetypebuttons ulsqsslidewrapperdataslidetypelockscreenscreen and maxwidth600pxsqsslidewrapperdataslidetypelockscreen2s easeinotransitionopacity 2sdataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypelockscreenaudioplayericonsstylesolid dataslicetypealbumhoverusemaskfill222sqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstyleknockout dataslicetypesocialiconshoversqsslidecontainerdataslidetypepopupoverlaynewsletterstyleoutlinedataslicetypealbumhoverresponsivewrapperdataslicetypealbumuseiconfill222sqsslidewrapperdataslidetypelockscreendataslicetypesocialicons googleactionsstackedeaseinmstransitionopacity 2seaseinoutmstransitionbackgroundcolordataslicetypesocialiconshover snapchatsqsslidesqsslideanimationreadyvideoiconstyleborderdataslicetypesocialiconshover youtubehover170mssocialstackedtextalignleftsvgsocialbackgroundcolortransparentsqsslidewrapperdataslidetypelockscreenbehancesqsslidecontainerdataslidetypepopupoverlaybuttonlayoutstyleauto dataslicetypebuttonsspansqsslidewrapperdataslidetypelockscreenlockstyleknockout dataslicetypelockdataslicetypesocialiconshover dropboxhovereaseinoutmoztransitionbackgroundcolor 170msformwrapper p2emfielderrordisplayblockpositionabsoluteboxsizingborderboxpadding25emasqsslidewrapperdataslidetypelockscreenul lipdataslicetypesocialicons houzztracks trackreddithover0 0sqsslidewrapperdataslidetypelockscreencodepenbuttonstyleoutline sqsslicecustomformeaseinoutdataslicetypesocialicons behancesqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstylestackedsqsslicecustomform asqsslidewrapperdataslidetypelockscreendataslicetypesocialicons smugmugdataslicetypebuttons li asqsslidewrapperdataslidetypelockscreensnapchathoversqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabledbuttonstyleoutline dataslicetypebuttons liautoflex1yelphoversocialiconsstyleknockoutitunesgoogledataslicetypealbum sqsslicealbumplaylistdemoalbumuseiconfill00b4b3sqsslidewrapperdataslidetypelockscreenapplepodcastuseiconfillec4652sqsslidewrapperdataslidetypelockscreendataslicetypesocialiconshover vscohoverdataslicetypebuttons ul lisqsslidewrapperdataslidetypelockscreendataslicetypesocialiconshover githubuseiconfill0976b4sqsslidewrapperdataslidetypelockscreensqsslidecontainerdataslidetypepopupoverlay captchacontainerwrapperdataslicetypesocialiconshover reddithoveruseiconfill222sqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstyleregulardataslicetypesocialicons instagramsoundcloudhovergoodreadshoverstumbleuponhoverfivehundredpixtwitchhoveralldataslicetypebuttons ahoversqsslidewrapperdataslidetypelockscreeneaseinotransitionopacity 2scountdowncontentdataformattextual countdownunituseiconfill00b488sqsslidewrapperdataslidetypelockscreeneaseinouttransitioncolordataslicetypebuttons li ahoversqsslidewrapperdataslidetypelockscreensqsslidecontainernotautoimagebackgroundcoloruleaseinmoztransitionopacitysvgsocialwebkittransitionbackgroundcolor 170ms easeinoutmoztransitionbackgroundcolor170ms easeinoutmstransitionbackgroundcolor 170msdataslicetypesocialiconshover imdblinkedinhoversocialiconsstylesolid dataslicetypesocialiconshover iconwrapperhoversvgsocialwebkittransitionbackgroundcolor 170msdataslicetypesocialiconshover smugmugsocialiconssizeextralargesocialiconsstylesoliddataslicetypesocialicons rdiolightboxinner lightboxcontent formwrapperreddit1vsco10pxbuttonstyleoutline datacompoundtypepopupoverlayactiondataslicetypesocialiconshover email170ms easeoutopacityeaseinoutmoztransitionbackgroundcolorsocialiconscolorstandardsocialiconsstyleknockout dataslicetypesocialiconscountdowncontentdataformattextualuseiconfillf60sqsslidewrapperdataslidetypelockscreendataslicetypemap gmstyleccsocialiconssizesmallsocialiconsstyleregularsqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinline actionsstacked inputwrappersqssliceplaybuttoniconwrapperhoverdataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypelockscreen socialiconssizelargesocialiconsstyleknockoutuseiconfill6441a5sqsslidewrapperdataslidetypelockscreenuseiconfilldc4e41sqsslidewrapperdataslidetypelockscreeneaseinoutotransitionbackgroundcolor170ms easeinouttransitionbackgroundcolorli ahoversqsslidewrapperdataslidetypelockscreensvgsocialbackgroundcolor222sqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstyleregularbuttonstyleraisedsqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstylestacked inputwrappervscohoverdataslicetypealbum iconwrappersqsslidewrapperdataslidetypelockscreen170ms easeinoutotransitionbackgroundcolorresponsivewrapperstacked7pxformitemsqsslidewrapperdataslidetypelockscreencountdownunitactionsnotstacked inputwrappernothiddeniconwrapperborder2pxcountdowncontentdataformatnumericdataslicetypesocialiconshover instagramhoverdataslicetypealbum sqsslicealbumplaylistplayingsqsslidecontainerdataslidetypepopupoverlayoverlayalignmentleftonly screendataslicetypesocialiconshover redditsqsslidecontainerdataslidetypepopupoverlaybuttonstyleoutline0pxsqsslicealbumplaylistdemoalbumdataslicetypebodydataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypelockscreen socialiconssizemediumsocialiconsstylesolidactionsnotstackedimdbsqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinline actionsstacked inputwrappernothiddenshowtracktitle sqsalbumminimalbuttonplaypausedataslicetypesocialiconshover squarespacehoveruseiconfillfffsqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconsmaxwidth600pxsqsslidewrapperdataslidetypelockscreensocialiconscolorstandardsocialiconsstyleborder dataslicetypesocialiconsuseiconfill5adfcbsqsslidewrapperdataslidetypelockscreen2s easeinmstransitionopacity 2sdataslicetypesocialiconshover tidalbordercolorsqsslicealbumplaylist tracksthedotsmapstyleminimaldarkeaseinoutmstransitionbackgroundcolor 170ms easeinoutotransitionbackgroundcolordataslicetypesocialiconshover codependataslicetypesocialiconshover pinterestsocialiconssizeextrasmallsocialiconsstylesolidsqsslicealbumplayliststackedtrackdataslicetypealbum tracktitlesqsalbumminimaldataslicetypesocialiconshover goodreadshoversqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabled dataslicetypebody pinputtypetextsqsslidewrapperdataslidetypelockscreen sqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinlineasqsslidewrapperdataslidetypelockscreen buttonstyleoutline sqsslicecustomformasqsslidewrapperdataslidetypelockscreen buttonstyleoutlinesocialiconscolorstandardsocialiconsstyleknockoutlockstyleborder dataslicetypelockinputtypesubmithoversqsslidewrapperdataslidetypelockscreendataslicetypesocialiconshover tumblriconwrappersqsslidewrapperdataslidetypelockscreen socialiconssizeextralargesocialiconsstylesoliddataslicetypesocialicons facebooksquarespacesqsslicedatacontentemptytruedisplaynonesqsslidewrapperdataslidetypelockscreenformwrapper inputtypesubmithoversqsslidewrapperdataslidetypelockscreenuseiconfill35465dsqsslidewrapperdataslidetypelockscreendataslicetypesocialiconshover codepenhoverdatacompoundtypepopupoverlayaction errormessagesqsslidewrapperdataslidetypelockscreenusemaskfill222sqsslidewrapperdataslidetypelockscreendataslicetypecountdownsqsmodallightboxopenusebackgroundfillfffsqsslidewrapperdataslidetypelockscreentweettimestampdataslicetypesocialiconshover dropbox0dataslicetypesocialiconshover meetupiconwrapperwidth28pxheight28pxmargin02s easesqsslidewrapperdataslidetypelockscreendataslicetypesocialicons svgsocialbackgroundcolortransparentsqsslidewrapperdataslidetypelockscreengithubpasswordstylerectangleuseiconfill222sqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstyleborderdataslicetypesocialicons dribbble2s easeintransitionopacity 2sdataslicetypesocialicons emailsocialiconsstyleregular dataslicetypesocialiconssvgsocialbackgroundcolor222sqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstylesolidemailiconwrapperhoversqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabledsolidbuttonshaperoundedcornersbuttonstyleoutlinesqsmodallightbox formwrapper0msdribbblehoversqsslidewrapperdataslidetypelockscreen responsivewrappernotstackedsocialiconsstylesolid dataslicetypesocialicons1suseiconfille52d27sqsslidewrapperdataslidetypelockscreenrdiohoverdataslicetypesocialiconshover emailhoveruseiconfill55aceesqsslidewrapperdataslidetypelockscreendataslicetypesocialicons vinegalleryvideobackgroundmobiledataslicetypesocialicons thedotsuseiconfillfffsqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstylesolid2s easeinmoztransitionopacity 2sdataslicetypesocialiconshover dribbblehoverdataslicetypesocialiconsdataslicetypesocialicons applepodcastresponsivewrapperstackedtextaligncenteractionsstacked inputwrappernothiddensqsslicealbumplaylistplayingdataslicetypesocialiconshover bandsintowndataslicetypesocialiconshover vinehoverinstagramdataslicetypesocialiconshover stumbleuponhoversocialiconscolorstandardsocialiconsstyleknockout dataslicetypesocialiconshoveronlydataslicetypesocialicons imdbeaseinmstransitionopacityahoversqsslidewrapperdataslidetypelockscreendataslicetypesocialiconshover vinesocialiconssizeextralargesocialiconsstylebordersqsslidewrapperdataslidetypelockscreen dataslicetypecountdown countdowncontentdataformatnumericsqsslidecontainerdataslidetypepopupoverlaybuttonlayoutstyleinlineautomediumhover170ms easeinouttransitionbackgroundcolor 170msadisplayblocksqsslidewrapperdataslidetypelockscreenaudioplayericonsstyleborderdropboxhoversqsalbumminimal dataslicetypealbum sqsslicealbumplaylistdemoalbumdataslicetypegallery galleryvideobackgrounddataslicetypesocialiconshover imdbhoversocialiconssizemediumsocialiconsstyleknockoutdataslicetypesocialicons rssdataslicetypesocialiconshover stitchersmugmugemailhoverlightboxcontent formwrapper pdataslicetypesocialicons vimeodataslicetypesocialiconshover yelpsqsslidecontainerdataslidetypepopupoverlaybuttonlayoutstyleinline dataslicetypebuttonssqsslicecustomformsqsslidewrapperdataslidetypelockscreendataslicetypesocialicons itunessvgsocialbackgroundcolorrgba3434344sqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconshoverli14pxdataslicetypesocialicons spotifybordercolor 170msvideoiconstylesoliddataslicetypesocialicons stumbleuponformitemsqsslidewrapperdataslidetypelockscreen sqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinlinesocialiconssizemediumsocialiconsstyleregulardataslicetypebuttonsdataslicetypemap gmnoprintdataslicetypesocialiconshover tumblrhoverbuttonsqsslidewrapperdataslidetypelockscreentwitchuseiconfillrgba3434344sqsslidewrapperdataslidetypelockscreenuseiconfillea4c89sqsslidewrapperdataslidetypelockscreen2s easeinmstransitionopacitytweethandledataslicetypesocialiconshover houzzhoverimdbhover170ms easeinout bordercolorsocialiconsstylesolid dataslicetypesocialiconshover iconwrappereaseinoutsqsslidewrapperdataslidetypelockscreendataslicetypenavigation uldatacompoundtypepopupoverlayaction inputtypetextsqsslidewrapperdataslidetypelockscreendataslicetypesocialicons linkedinsqsslidecontainerdataslidetypepopupoverlayoverlayloadanimationslideinsqsslidecontainerdataslidetypepopupoverlay datacompoundtypepopupoverlayactiondataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypelockscreen socialiconssizeextrasmallsocialiconsstylesoliddataslicetypesocialiconshover facebooksqsslidecontainerdataslidetypepopupoverlaynewsletterstyleoutline datacompoundtypepopupoverlayactionsqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabledbuttonstyleoutlinedataslicetypesocialiconshover soundcloudhoverlockstyleknockoutsocialiconssizeextralargesocialiconsstyleregulareaseinoutotransitionbackgroundcolor 170msdataslicetypetwitternotdatacompoundtype tweettimestampeaseinoutmstransitioncolorvideoiconstyleknockoutuseiconfillff4500sqsslidewrapperdataslidetypelockscreenbuttonstylesoliddataslicetypepasswordusemaskfillrgba3434344sqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstyleknockoutusebackgroundfilltransparentsqsslidewrapperdataslidetypelockscreen170ms easeoutopacity 170ms2em 0pxdataslicetypesocialicons codepensqsslidecontainerdataslidetypepopupoverlaynewsletterstyleunderlined datacompoundtypepopupoverlayactionsocialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconshoverdataslicetypesocialicons fivehundredpixdataslicetypesocialicons twitteruseiconfilleb4924sqsslidewrapperdataslidetypelockscreensqsslicecustomform spansqsslidewrapperdataslidetypelockscreensocialiconscolorstandardsocialiconsstyleregular dataslicetypesocialiconshoveruseiconfill1769ffsqsslidewrapperdataslidetypelockscreensocialiconscolorstandardsocialiconsstylesoliduseiconfill006ed2sqsslidewrapperdataslidetypelockscreenuseiconfillcc2127sqsslidewrapperdataslidetypelockscreendataslicetypesocialiconshover vimeohovereaseinouttransitionbackgroundcolor 170msdataslicetypesocialicons bandsintowndataslicetypebuttons liuseiconfillrgba2552552554sqsslidewrapperdataslidetypelockscreenuseiconfill1ea9e1sqsslidewrapperdataslidetypelockscreenlightboxinner lightboxcontentdataslicetypealbum sqsslicealbumplaylistsqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinlineinstagramhoverituneshoverdataslicetypegallerysqsgallerygridinputtypesubmitsqsslidewrapperdataslidetypelockscreen buttonstyleoutline datacompoundtypepopupoverlayactiondataslicetypesocialiconshover applepodcastdataslicetypebuttons uluseiconfille6b91esqsslidewrapperdataslidetypelockscreenaudioplayericonsstylesolidrssdribbblemeetupbuttonstyleoutlinedataslicetypesocialiconshover soundcloudtrackstweetavataruseiconfillrgba2552552554sqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconshoversqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinline actionsnotstackedsqsslicecustomform ahoversqsslidewrapperdataslidetypelockscreendataslicetypesocialiconshover mediumhoversqsslidewrapperdataslidetypelockscreen dataslicetypecountdowninputtypepasswordsqsslidewrapperdataslidetypelockscreendataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypelockscreen socialiconssizesmallsocialiconsstylesolidresponsivewrapperstacked sqsslicecustomformeaseinotransitionopacityeaseinout bordercolor 170msdataslicetypesocialiconshover flickrhoverrsshoverdataslicetypesocialiconshover iconwrapperhoverdataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypelockscreen socialiconssizeextrasmallsocialiconsstyleknockoutflickrhoverstitcherhoversocialiconssizelargesocialiconsstyleborderuseiconfill8c8070sqsslidewrapperdataslidetypelockscreendataslicetypealbum iconwrappersqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabledbuttonstyleoutline datacompoundtypepopupoverlayactionbuttonshapepillbuttontypesubmitsqsslidewrapperdataslidetypelockscreensocialiconssizeextrasmallsocialiconsstyleregular2s 2sgmnoprintdataslicetypepassword arrowicondataslicetypesocialiconshover vevouseiconfill3b5998sqsslidewrapperdataslidetypelockscreeniconwrapperlastchildsqsslidewrapperdataslidetypelockscreensqsslidecontainerdataslidetypepopupoverlaynewsletterstylerectangle datacompoundtypepopupoverlayactionuseiconfill007ee5sqsslidewrapperdataslidetypelockscreendataslicetypesocialicons soundcloudsqsmodallightboxcontent lightboxinner lightboxcontentfacebooksocialiconscolorstandardsocialiconsstyleregularpinteresthoverdataslicetypecountdown countdowncontentdataformattextualdisclaimercontainersqsslidewrapperdataslidetypelockscreenlightboxinnerdataslicetypesocialiconshover dribbbleiconwrappersqsslidewrapperdataslidetypelockscreen socialiconssizesmallsocialiconsstylesolidlightboxcontenteaseinoutotransitionbackgroundcolor 170ms easeinouttransitionbackgroundcolorbandsintownhoverdataslicetypesocialicons flickr2em 0px 0pxsocialiconssizemediumsocialiconsstyleborderuseiconfillrgba3434344sqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstyleregular dataslicetypesocialiconshoveruseiconfillfffsqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconshovertidalhoverusemaskfillfffsqsslidewrapperdataslidetypelockscreendataslicetypesocialicons vscodataslicetypesocialicons stitchericonwrappersqsslidewrapperdataslidetypelockscreen socialiconssizeextralargesocialiconsstyleknockoutdataslicetypesocialiconshover twitchhoversqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabled datacompoundtypepopupoverlayactionusemaskfillrgba3434344sqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstyleknockout dataslicetypesocialiconshoversqsslidewrapperdataslidetypelockscreen dataslicetypebuttonsinputwrapperdataslicetypealbum sqsslicealbumplaylist tracksdataslicetypesocialiconshover twitchsqsmodallightboxcontent lightboxinnermeetuphoveruseiconfille4405fsqsslidewrapperdataslidetypelockscreensvgsocialbackgroundcolorrgba3434344sqsslidewrapperdataslidetypelockscreendataslicetypesocialicons snapchatactionsstacked inputwrapperdataslicetypesocialiconshover githubhoveraudioplayericonsstyleregular dataslicetypealbumiconwrappersqsslidewrapperdataslidetypelockscreen socialiconssizemediumsocialiconsstyleknockoutdataslicetypealbum iconwrapperlastchildsqsslidewrapperdataslidetypelockscreenlockstylesoliddataslicetypetwitternotdatacompoundtypedataslicetypesocialiconshover rdiohoverfielderrordisplayblockpositionabsoluteboxsizingborderboxpadding25em 5emfont14pxsnapchat100mstracktitleeaseoutopacity 170msdataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypelockscreen socialiconssizelargesocialiconsstylesoliddataslicetypesocialiconshover thedotshoverdataslicetypesocialiconshover yelphoverinputtypetextmozplaceholdercolorrgba1631631635sqsslidewrapperdataslidetypelockscreenuseiconfill7ac143sqsslidewrapperdataslidetypelockscreenlockstylebordericonwrapperwidth36pxheight36pxmargin0socialiconscolorstandardsocialiconsstylebordericonwrapperdivwebkittransformscale2moztransformscale2mstransformscale2transformscale2sqsslidewrapperdataslidetypelockscreensqsslicealbumplaylistfffsqsslidewrapperdataslidetypelockscreeneaseinmoztransitionopacity 2sgoogleplaydataslicetypebuttons asqsslidewrapperdataslidetypelockscreendataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypelockscreen socialiconssizeextralargesocialiconsstylesolidlinkedindisplaytablesqsslidewrapperdataslidetypelockscreenulstackedsqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabledbuttonstyleoutline dataslicetypebuttonshouzzdataslicetypetwitter1pxsocialiconssizeextralargesocialiconsstyleknockoutdataslicetypesocialiconshover houzzuseiconfillfffsqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstyleknockout dataslicetypesocialiconsformwrapper inputtypesubmitsqsslidewrapperdataslidetypelockscreen buttonstyleoutlineusemaskfill222sqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstyleknockoutuseiconfillfffsqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstyleknockoutdataslicetypemapgoodreadsbuttonstyleoutlinesqsmodallightbox formwrapper inputtypesubmitsqsslidewrapperdataslidetypelockscreenresponsivewrapperstacked dataslicetypebuttonsstitcherdataslicetypesocialicons githubneuearialsansseriffontweightnormalfontstylenormalletterspacing6pxsqsslidewrapperdataslidetypelockscreeniconwrapperwidth32pxheight32pxmargin0sqsalbumminimal dataslicetypealbumvinehoverdataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypelockscreen socialiconssizemediumsocialiconsstyleknockoutdataslicetypesocialiconshover stitcherhoveruseiconfill4183c4sqsslidewrapperdataslidetypelockscreeneaseintransitionopacity 2s170ms easeinoutsocialiconssizelargesocialiconsstylesoliduseiconfill7dbb00sqsslidewrapperdataslidetypelockscreendataslicetypesocialiconshover twitterhoverscreensqsslidecontainerdataslidetypepopupoverlaybuttonlayoutstyleinlineauto dataslicetypebuttonsinputtypetextsqsslidewrapperdataslidetypelockscreensocialiconssizeextrasmallsocialiconsstylebordergithubhoversqsslidecontainerdataslidetypepopupoverlaynewsletterstyleunderlineddataslicetypesocialicons googleplayuseiconfill222backgroundcolor222sqsslidewrapperdataslidetypelockscreenimportantsqsslidewrapperdataslidetypelockscreen sqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinlinesqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinline actionsnotstacked inputwrappernothiddenarrowiconuseiconfill84bd00sqsslidewrapperdataslidetypelockscreendataslicetypesocialicons squarespaceeaseintransitionopacityformwrapper170ms easeinoutmoztransitionbackgroundcolor 170msgalleryvideobackgrounddatacompoundtypepopupoverlayaction inputtypetextmozplaceholdercolorrgba1631631635sqsslidewrapperdataslidetypelockscreendataslicetypebuttons ul lidataslicetypesocialiconshover foursquarehoverfacebookhoverdataslicetypesocialiconshover linkedinhoversqsslidelayercontentusemaskfill222sqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconsvimeo

Longtail Keyword Density for Larazacrc.org

KeywordsOccurences
use-iconfillfffsqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-iconshover44
use-iconfillfffsqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-knockout data-slice-typesocial-icons44
use-iconfillfffsqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-icons44
use-iconfillrgba2552552554sqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-iconshover44
sqs-modal-lightbox-content lightbox-inner lightbox-content19
ease-in-out border-color 170ms15
170ms ease-in-out border-color15
lightbox-inner lightbox-content form-wrapper14
sqs-album-minimal data-slice-typealbum sqs-slice-album-playlist14
use-iconfill222sqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-border data-slice-typesocial-icons12
data-slice-typealbum sqs-slice-album-playlist tracks11
socialstacked data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typelock-screen10
socialstackedtext-align-left data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typelock-screen10
170ms ease-in-out-moz-transitionbackground-color 170ms8
170ms ease-in-out-ms-transitionbackground-color 170ms8
170ms ease-in-out-o-transitionbackground-color 170ms8
170ms ease-in-outtransitionbackground-color 170ms8
sqs-slice-album-playlist tracks track7
svgsocialbackground-color222sqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-regular data-slice-typesocial-icons6
show-track-title sqs-album-minimal data-slice-typealbum6
use-maskfill222sqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-icons6
2em 0px 0px6
use-iconfill222sqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-regular data-slice-typesocial-iconshover6
use-maskfillrgba3434344sqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-knockout data-slice-typesocial-iconshover6
svgsocialbackground-color222sqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-iconshover6
use-iconfillrgba3434344sqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-regular data-slice-typesocial-iconshover6
use-maskfill222sqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-knockout data-slice-typesocial-iconshover6
ease-in-outtransitionbackground-color 170ms ease-in-outsqs-slide-wrapperdata-slide-typelock-screen6
svgsocialbackground-colorrgba3434344sqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-iconshover6
ease-in-out-moz-transitionbackground-color 170ms ease-in-out-ms-transitionbackground-color6
ease-in-out-ms-transitionbackground-color 170ms ease-in-out-o-transitionbackground-color6
ease-in-out-o-transitionbackground-color 170ms ease-in-outtransitionbackground-color6
data-slice-typebuttons li asqs-slide-wrapperdata-slide-typelock-screen5
170ms ease-outopacity 170ms5
data-slice-typenavigation ul li5
svgsocial-webkit-transitionbackground-color 170ms ease-in-out-moz-transitionbackground-color4
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline actionsnotstacked input-wrappernothidden4
all and max-width600pxsqs-slide-wrapperdata-slide-typelock-screen4
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabledbutton-style-outline data-slice-typebuttons li4
data-slice-typebuttons ul lisqs-slide-wrapperdata-slide-typelock-screen4
data-slice-typebuttons ul li4
lightbox-content form-wrapper p4
social-icons-style-solid data-slice-typesocial-iconshover icon-wrapperhover4
responsive-wrapperstacked data-slice-typenavigation ul4
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabled data-slice-typebody p4
responsive-wrapperstacked data-slice-typebuttons ul3
sqs-slide-wrapperdata-slide-typelock-screen data-slice-typecountdown countdown-contentdata-formatnumeric3
data-slice-typecountdown countdown-contentdata-formattextual countdown-unit3
button-style-outlinesqs-modal-lightbox form-wrapper inputtypesubmitsqs-slide-wrapperdata-slide-typelock-screen3
form-wrapper inputtypesubmitsqs-slide-wrapperdata-slide-typelock-screen button-style-outline3
social-icons-style-solid data-slice-typesocial-iconshover icon-wrapper3
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline actionsstacked input-wrapper3
buttonsqs-slide-wrapperdata-slide-typelock-screen sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline actionsstacked3
data-slice-typebuttons li ahoversqs-slide-wrapperdata-slide-typelock-screen3
inputtypesubmitsqs-slide-wrapperdata-slide-typelock-screen button-style-outline data-compound-typepopup-overlay-action3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typelock-screen social-icons-size-smallsocial-icons-style-knockout3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typelock-screen social-icons-size-extra-largesocial-icons-style-solid3
sqs-album-minimal data-slice-typealbum sqs-slice-album-playliststacked3
ul li asqs-slide-wrapperdata-slide-typelock-screen3
2s ease-in-moz-transitionopacity 2s3
2s ease-in-ms-transitionopacity 2s3
2s ease-in-o-transitionopacity 2s3
2s ease-intransitionopacity 2s3
border-color 170ms ease-in-outsqs-slide-wrapperdata-slide-typelock-screen3
sqs-album-minimal data-slice-typealbum sqs-slice-album-playlistdemo-album3
screen and max-width600pxsqs-slide-wrapperdata-slide-typelock-screen3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typelock-screen social-icons-size-extra-largesocial-icons-style-knockout3
asqs-slide-wrapperdata-slide-typelock-screen button-style-outline sqs-slice-custom-form3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typelock-screen social-icons-size-extra-smallsocial-icons-style-knockout3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typelock-screen social-icons-size-extra-smallsocial-icons-style-solid3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typelock-screen social-icons-size-smallsocial-icons-style-solid3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typelock-screen social-icons-size-mediumsocial-icons-style-knockout3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typelock-screen social-icons-size-mediumsocial-icons-style-solid3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typelock-screen social-icons-size-largesocial-icons-style-knockout3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typelock-screen social-icons-size-largesocial-icons-style-solid3
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline actionsstacked input-wrappernothidden3
social-icons-color-standardsocial-icons-style-border data-slice-typesocial-icons176
social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-iconshover176
social-icons-color-standardsocial-icons-style-knockout data-slice-typesocial-iconshover88
social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-icons88
use-iconfillfffsqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-solid88
social-icons-color-standardsocial-icons-style-regular data-slice-typesocial-iconshover88
use-iconfillrgba2552552554sqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-solid44
social-icons-color-standardsocial-icons-style-knockout data-slice-typesocial-icons44
use-iconfillfffsqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-knockout44
social-icons-color-standardsocial-icons-style-regular data-slice-typesocial-icons44
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typelock-screen34
sqs-album-minimal data-slice-typealbum25
sqs-modal-lightbox-content lightbox-inner21
socialstackedtext-align-left data-slice-typesocial-icons20
socialstacked data-slice-typesocial-icons20
lightbox-inner lightbox-content19
data-slice-typecountdown countdown-contentdata-formatnumeric18
data-slice-typealbum sqs-slice-album-playlist15
170ms ease-in-out15
ease-in-out border-color15
border-color 170ms15
lightbox-content form-wrapper14
data-slice-typegallery gallery-video-background14
170ms ease-in-outsqs-slide-wrapperdata-slide-typelock-screen13
data-slice-typebuttons ul12
use-iconfill222sqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-border12
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline actionsnotstacked12
sqs-slide-containerdata-slide-typepopup-overlay data-compound-typepopup-overlay-action12
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline actionsstacked11
data-slice-typealbum icon-wrapper11
sqs-slice-album-playlist tracks11
data-slice-typecountdown countdown-contentdata-formattextual11
0 0sqs-slide-wrapperdata-slide-typelock-screen11
data-slice-typebuttons li10
password-style-underlined data-slice-typepassword10
data-slice-typenavigation ul10
data-slice-typealbum icon-wrapperlast-childsqs-slide-wrapperdata-slide-typelock-screen10
data-slice-typealbum icon-wrapperlast-childmargin-right0sqs-slide-wrapperdata-slide-typelock-screen10
data-slice-typealbum icon-wrappersqs-slide-wrapperdata-slide-typelock-screen10
ul li9
password-style-rectangle data-slice-typepassword9
social-icons-style-solid data-slice-typesocial-iconshover8
170ms ease-in-outtransitionbackground-color8
data-slice-typebody p8
ease-in-outtransitionbackground-color 170ms8
ease-in-out-o-transitionbackground-color 170ms8
170ms ease-in-out-o-transitionbackground-color8
ease-in-out-ms-transitionbackground-color 170ms8
170ms ease-in-out-ms-transitionbackground-color8
ease-in-out-moz-transitionbackground-color 170ms8
data-slice-typebuttons asqs-slide-wrapperdata-slide-typelock-screen8
li asqs-slide-wrapperdata-slide-typelock-screen8
170ms ease-in-out-moz-transitionbackground-color8
sqs-slice-custom-form asqs-slide-wrapperdata-slide-typelock-screen7
social-icons-style-border data-slice-typesocial-icons7
show-track-title sqs-album-minimal7
tracks track7
button-style-outlinesqs-modal-lightbox form-wrapper7
button-style-outline data-compound-typepopup-overlay-action7
use-iconfill222sqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-regular6
use-iconfillrgba3434344sqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-regular6
use-maskfill222sqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-knockout6
use-maskfillrgba3434344sqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-knockout6
use-maskfill222sqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-solid6
svgsocialbackground-color222sqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-solid6
svgsocialbackground-colorrgba3434344sqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-solid6
svgsocialbackground-color222sqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-regular6
form-wrapper inputtypesubmitsqs-slide-wrapperdata-slide-typelock-screen6
button-style-outline sqs-slice-custom-form6
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-style-rectangle data-compound-typepopup-overlay-action6
data-slice-typebuttons ulsqs-slide-wrapperdata-slide-typelock-screen6
data-slice-typesocial-iconshover icon-wrapperhover6
2em 0px6
data-slice-typealbum track-progress-bar6
audio-player-icons-style-border data-slice-typealbum6
0px 0px6
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-style-outline data-compound-typepopup-overlay-action6
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabled data-compound-typepopup-overlay-action6
button-style-outline data-slice-typebuttons6
ease-outopacity 170ms5
data-slice-typesocial-icons dropbox5
170ms ease-outopacity5
data-slice-typesocial-icons twitch5
ul lisqs-slide-wrapperdata-slide-typelock-screen5
responsive-wrapperstacked data-slice-typenavigation5
data-slice-typesocial-icons instagram5
data-slice-typesocial-icons dribbble5
asqs-slide-wrapperdata-slide-typelock-screen button-style-outline5
data-slice-typesocial-icons tumblr5
data-slice-typesocial-icons codepen5
data-slice-typesocial-icons spotify5
data-slice-typesocial-icons goodreads5
data-slice-typesocial-icons stitcher5
data-slice-typesocial-icons github5
data-slice-typesocial-icons google5
responsive-wrapperstacked data-slice-typebuttons5
data-slice-typesocial-icons foursquare5
data-slice-typesocial-icons stumbleupon5
data-slice-typesocial-icons flickr5
data-slice-typesocial-icons soundcloud5
data-slice-typesocial-icons houzz5
data-slice-typesocial-icons thedots5
data-slice-typesocial-icons fivehundredpix5
data-slice-typesocial-icons facebook5
data-slice-typesocial-icons tidal5
data-slice-typesocial-icons imdb5
data-slice-typesocial-icons email5
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabled data-slice-typebody5
data-slice-typesocial-icons twitter5
data-slice-typesocial-icons squarespace5
data-slice-typesocial-icons vimeo5
data-slice-typesocial-icons reddit5
data-slice-typesocial-icons pinterest5
data-slice-typesocial-icons yelp5
data-slice-typesocial-icons youtube5
sqs-slide-wrapperdata-slide-typelock-screen data-slice-typebuttons5
data-slice-typesocial-iconshover icon-wrapper5
data-slice-typesocial-icons meetup5
data-slice-typesocial-icons rss5
data-slice-typesocial-icons vsco5
lock-style-regular data-slice-typelock5
data-slice-typesocial-icons medium5
data-slice-typesocial-icons googleplay5
data-slice-typesocial-icons smugmug5
data-slice-typesocial-icons vine5
data-slice-typesocial-icons rdio5
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-style-underlined data-compound-typepopup-overlay-action5
data-slice-typesocial-icons linkedin5
0ms 0ms5
data-slice-typesocial-icons applepodcast5
data-slice-typesocial-icons behance5
data-slice-typesocial-icons snapchat5
data-slice-typesocial-icons itunes5
data-slice-typesocial-icons vevo5
data-slice-typealbum sqs-slice-album-playlistplaying5
data-slice-typesocial-icons bandsintown5
2s 2s5
data-slice-typesocial-iconshover spotifyhover4
data-slice-typesocial-iconshover spotify4
data-slice-typesocial-iconshover smugmughover4
data-slice-typesocial-iconshover reddit4
data-slice-typesocial-iconshover reddithover4
data-slice-typesocial-iconshover snapchathover4
data-slice-typesocial-iconshover rss4
data-slice-typesocial-iconshover soundcloudhover4
data-slice-typesocial-iconshover soundcloud4
data-slice-typesocial-iconshover smugmug4
data-slice-typesocial-iconshover rsshover4
data-slice-typesocial-iconshover snapchat4
data-slice-typesocial-iconshover tumblrhover4
data-slice-typesocial-iconshover squarespace4
form-wrapper p4
data-slice-typesocial-iconshover yelp4
data-slice-typesocial-iconshover yelphover4
data-slice-typesocial-iconshover youtube4
data-slice-typesocial-iconshover youtubehover4
data-slice-typesocial-iconshover vscohover4
data-slice-typesocial-iconshover vsco4
data-slice-typesocial-iconshover vinehover4
data-slice-typesocial-iconshover vine4
data-slice-typesocial-iconshover vimeohover4
data-slice-typesocial-iconshover vimeo4
data-slice-typesocial-iconshover vevohover4
data-slice-typesocial-iconshover vevo4
data-slice-typesocial-iconshover twitterhover4
data-slice-typesocial-iconshover squarespacehover4
data-slice-typesocial-iconshover twitter4
data-slice-typesocial-iconshover twitchhover4
data-slice-typesocial-iconshover twitch4
data-slice-typesocial-iconshover tumblr4
data-slice-typesocial-iconshover tidalhover4
data-slice-typesocial-iconshover tidal4
data-slice-typesocial-iconshover thedotshover4
data-slice-typesocial-iconshover thedots4
data-slice-typesocial-iconshover stumbleuponhover4
data-slice-typesocial-iconshover stumbleupon4
data-slice-typesocial-iconshover stitcherhover4
data-slice-typesocial-iconshover stitcher4
data-slice-typesocial-iconshover rdiohover4
data-slice-typesocial-iconshover google4
data-slice-typesocial-iconshover rdio4
social-icons-style-regular data-slice-typesocial-icons4
data-slice-typesocial-iconshover dropboxhover4
data-slice-typesocial-iconshover dropbox4
data-slice-typesocial-iconshover dribbblehover4
data-slice-typesocial-iconshover dribbble4
data-slice-typesocial-iconshover codepenhover4
data-slice-typesocial-iconshover codepen4
data-slice-typesocial-iconshover pinteresthover4
data-slice-typesocial-iconshover behance4
data-slice-typesocial-iconshover bandsintownhover4
data-slice-typesocial-iconshover bandsintown4
data-slice-typesocial-iconshover applepodcasthover4
data-slice-typesocial-iconshover applepodcast4
audio-player-icons-style-solid data-slice-typealbumhover4
data-slice-typesocial-iconshover facebook4
data-slice-typealbumhover icon-wrapper4
data-slice-typealbumhover icon-wrapperhover4
data-slice-typetwitternotdata-compound-type tweet-body4
lock-style-border data-slice-typelock4
actionsnotstacked input-wrappernothidden4
data-slice-typebuttons lisqs-slide-wrapperdata-slide-typelock-screen4
buttonsqs-slide-wrapperdata-slide-typelock-screen sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline4
svgsocial-webkit-transitionbackground-color 170ms4
data-compound-typepopup-overlay-action inputtypetextsqs-slide-wrapperdata-slide-typelock-screen4
data-compound-typepopup-overlay-action inputtypetext-moz-placeholdercolorrgba1631631635sqs-slide-wrapperdata-slide-typelock-screen4
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabledbutton-style-outline data-slice-typebuttons4
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabledbutton-style-outline data-compound-typepopup-overlay-action4
responsive-wrapperstacked sqs-slice-custom-form4
data-slice-typesocial-iconshover email4
data-slice-typesocial-iconshover behancehover4
data-slice-typesocial-iconshover facebookhover4
data-slice-typesocial-iconshover houzzhover4
data-slice-typesocial-iconshover pinterest4
data-slice-typesocial-iconshover meetuphover4
data-slice-typesocial-iconshover meetup4
data-slice-typesocial-iconshover mediumhover4
data-slice-typesocial-iconshover medium4
data-slice-typesocial-iconshover linkedinhover4
data-slice-typesocial-iconshover linkedin4
data-slice-typesocial-iconshover ituneshover4
data-slice-typesocial-iconshover itunes4
data-slice-typesocial-iconshover instagramhover4
data-slice-typesocial-iconshover instagram4
data-slice-typesocial-iconshover imdbhover4
data-slice-typesocial-iconshover imdb4
data-slice-typesocial-iconshover emailhover4
data-slice-typesocial-iconshover houzz4
data-slice-typesocial-iconshover foursquarehover4
data-slice-typesocial-iconshover github4
data-slice-typesocial-iconshover googlehover4
data-slice-typesocial-iconshover foursquare4
data-slice-typesocial-iconshover githubhover4
data-slice-typesocial-iconshover flickrhover4
data-slice-typesocial-iconshover goodreads4
data-slice-typesocial-iconshover flickr4
data-slice-typesocial-iconshover fivehundredpixhover4
data-slice-typesocial-iconshover goodreadshover4
data-slice-typesocial-iconshover fivehundredpix4
data-slice-typesocial-iconshover googleplay4
data-slice-typesocial-iconshover googleplayhover4
data-slice-typesocial-icons svgsocialbackground-colortransparentsqs-slide-wrapperdata-slide-typelock-screen3
li ahoversqs-slide-wrapperdata-slide-typelock-screen3
data-slice-typesocial-icons use-maskfilltransparentsqs-slide-wrapperdata-slide-typelock-screen3
form-wrapper inputtypesubmithoversqs-slide-wrapperdata-slide-typelock-screen3
social-icons-style-knockout data-slice-typesocial-icons3
actionsstacked input-wrapper3
social-icons-style-solid data-slice-typesocial-icons3
data-compound-typepopup-overlay-action error-messagesqs-slide-wrapperdata-slide-typelock-screen3
inputtypetextsqs-slide-wrapperdata-slide-typelock-screen sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline3
form-itemsqs-slide-wrapperdata-slide-typelock-screen sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline3
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-stacked input-wrapper3
importantsqs-slide-wrapperdata-slide-typelock-screen sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline3
field-errordisplayblockpositionabsolutebox-sizingborder-boxpadding25em 5emfont14px3
sqs-slide-containerdata-slide-typepopup-overlay captcha-container-wrapper3
sqs-slice-custom-form ahoversqs-slide-wrapperdata-slide-typelock-screen3
lock-style-knockout data-slice-typelock3
data-slice-typelock use-backgroundfilltransparentsqs-slide-wrapperdata-slide-typelock-screen3
data-slice-typetwitternotdata-compound-type tweet-timestamp3
lock-style-solid data-slice-typelock3
sqs-slide-wrapperdata-slide-typelock-screen responsive-wrappernotstacked3
data-slice-typebuttons ahoversqs-slide-wrapperdata-slide-typelock-screen3
audio-player-icons-style-regular data-slice-typealbum3
sqs-slice-custom-form spansqs-slide-wrapperdata-slide-typelock-screen3
data-slice-typebuttons ulstacked3
data-slice-typemap gmnoprint3
data-slice-typemap gm-style-cc3
only screen3
data-slice-typealbum sqs-slice-album-playliststacked3
data-slice-typealbum sqs-slice-album-playlistdemo-album3
data-slice-typealbum track-title3
data-slice-typegallery gallery-video-backgroundmobile3
data-slice-typetwitter tweet-avatar3
ease-intransitionopacity 2s3
2s ease-intransitionopacity3
ease-in-o-transitionopacity 2s3
2s ease-in-o-transitionopacity3
ease-in-ms-transitionopacity 2s3
2s ease-in-ms-transitionopacity3
ease-in-moz-transitionopacity 2s3
2s ease-in-moz-transitionopacity3
importantsqs-slide-wrapperdata-slide-typelock-screen sqs-slide-containernotauto-image-background-color3
data-compound-typepopup-overlay-action buttontypesubmitsqs-slide-wrapperdata-slide-typelock-screen3
asqs-slide-wrapperdata-slide-typelock-screen data-slice-typetwitter3
inputtypesubmitsqs-slide-wrapperdata-slide-typelock-screen button-style-outline3
icon-wrappersqs-slide-wrapperdata-slide-typelock-screen social-icons-size-extra-largesocial-icons-style-knockout3
sqs-slide-containerdata-slide-typepopup-overlaybutton-layout-style-inline-auto data-slice-typebuttons3
sqs-slide-containerdata-slide-typepopup-overlaybutton-layout-style-auto data-slice-typebuttons3
sqs-slide-containerdata-slide-typepopup-overlaybutton-layout-style-inline data-slice-typebuttons3
countdown-contentdata-formattextual countdown-unit3
sqs-slide-wrapperdata-slide-typelock-screen data-slice-typecountdown3
p ahoversqs-slide-wrapperdata-slide-typelock-screen3
p asqs-slide-wrapperdata-slide-typelock-screen3
ease-in-outsqs-slide-wrapperdata-slide-typelock-screen social-icons-style-solid3
icon-wrappersqs-slide-wrapperdata-slide-typelock-screen social-icons-size-extra-largesocial-icons-style-solid3
icon-wrappersqs-slide-wrapperdata-slide-typelock-screen social-icons-size-largesocial-icons-style-solid3
data-slice-typepassword inputtypepasswordsqs-slide-wrapperdata-slide-typelock-screen3
icon-wrappersqs-slide-wrapperdata-slide-typelock-screen social-icons-size-largesocial-icons-style-knockout3
icon-wrappersqs-slide-wrapperdata-slide-typelock-screen social-icons-size-mediumsocial-icons-style-solid3
icon-wrappersqs-slide-wrapperdata-slide-typelock-screen social-icons-size-mediumsocial-icons-style-knockout3
icon-wrappersqs-slide-wrapperdata-slide-typelock-screen social-icons-size-smallsocial-icons-style-solid3
icon-wrappersqs-slide-wrapperdata-slide-typelock-screen social-icons-size-smallsocial-icons-style-knockout3
icon-wrappersqs-slide-wrapperdata-slide-typelock-screen social-icons-size-extra-smallsocial-icons-style-solid3
icon-wrappersqs-slide-wrapperdata-slide-typelock-screen social-icons-size-extra-smallsocial-icons-style-knockout3
data-slice-typepassword arrow-icon3
2s easesqs-slide-wrapperdata-slide-typelock-screen3
actionsstacked input-wrappernothidden3
data-slice-typesocial-icons440
data-slice-typesocial-iconshover364
social-icons-color-standardsocial-icons-style-solid264
social-icons-color-standardsocial-icons-style-border176
use-iconfillfffsqs-slide-wrapperdata-slide-typelock-screen142
social-icons-color-standardsocial-icons-style-regular132
social-icons-color-standardsocial-icons-style-knockout132
data-slice-typealbum109
170ms90
data-compound-typepopup-overlay-action60
data-slice-typebuttons59
sqs-slide-containerdata-slide-typepopup-overlay55
icon-wrappersqs-slide-wrapperdata-slide-typelock-screen46
use-iconfillrgba2552552554sqs-slide-wrapperdata-slide-typelock-screen44
2s41
asqs-slide-wrapperdata-slide-typelock-screen38
data-slice-typecountdown35
importantsqs-slide-wrapperdata-slide-typelock-screen34
data-slice-typegallery33
data-slice-typelock30
data-slice-typepassword29
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline29
form-wrapper28
sqs-album-minimal27
1s25
use-iconfill222sqs-slide-wrapperdata-slide-typelock-screen24
sqs-modal-lightbox-content24
sqs-slice-custom-form24
0sqs-slide-wrapperdata-slide-typelock-screen24
icon-wrapper23
lightbox-inner22
ul22
responsive-wrapperstacked21
socialstackedtext-align-left20
sqs-slide-wrapperdata-slide-typelock-screen20
socialstacked20
li20
020
lightbox-content19
button-style-outline19
countdown-contentdata-formatnumeric18
sqs-slice-album-playlist17
data-slice-typenavigation17
ease-in-outsqs-slide-wrapperdata-slide-typelock-screen17
tracks16
data-slice-typebody16
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabled15
ease-in-out15
border-color15
gallery-video-background14
ahoversqs-slide-wrapperdata-slide-typelock-screen13
sqs-modal-lightbox-open13
p13
social-icons-style-solid12
use-maskfill222sqs-slide-wrapperdata-slide-typelock-screen12
0px12
svgsocialbackground-color222sqs-slide-wrapperdata-slide-typelock-screen12
actionsnotstacked12
icon-wrapperhover12
password-style-rectangle11
password-style-underlined11
data-slice-typetwitter11
countdown-contentdata-formattextual11
actionsstacked11
sqs-slice-play-buttonicon-wrappersqs-slide-wrapperdata-slide-typelock-screen10
squarespace10
icon-wrapperlast-childmargin-right0sqs-slide-wrapperdata-slide-typelock-screen10
lisqs-slide-wrapperdata-slide-typelock-screen10
data-slice-typetwitternotdata-compound-type10
icon-wrapperlast-childsqs-slide-wrapperdata-slide-typelock-screen10
110
solid10
0ms10
vimeo9
thedots9
tidal9
tumblr9
twitch9
twitter9
vevo9
rdio9
codepen9
behance9
bandsintown9
stumbleupon9
vsco9
yelp9
youtube9
applepodcast9
vine9
soundcloud9
stitcher9
googleplay9
meetup9
reddit9
medium9
linkedin9
itunes9
instagram9
imdb9
houzz9
google9
goodreads9
pinterest9
rss9
github9
smugmug9
flickr9
fivehundredpix9
facebook9
email9
snapchat9
dropbox9
dribbble9
spotify9
foursquare9
all9
ease-in-out-ms-transitionbackground-color9
max-width600pxsqs-slide-wrapperdata-slide-typelock-screen9
ease-in-out-o-transitionbackground-color9
ease-in-out-moz-transitionbackground-color9
ease-in-outtransitionbackground-color9
data-slice-typealbumhover8
sqs-slide-containerdata-slide-typepopup-overlayoverlay-alignment-center8
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabledbutton-style-outline8
sqs-slice-play-buttonicon-wrapper8
use-iconfillrgba3434344sqs-slide-wrapperdata-slide-typelock-screen7
track7
social-icons-style-border7
button-style-outlinesqs-modal-lightbox7
use-backgroundfillfffsqs-slide-wrapperdata-slide-typelock-screen7
use-backgroundfilltransparentsqs-slide-wrapperdata-slide-typelock-screen7
spansqs-slide-wrapperdata-slide-typelock-screen7
video-icon-style-border7
inputtypetextsqs-slide-wrapperdata-slide-typelock-screen7
data-slice-typemap7
input-wrappernothidden7
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-stacked7
show-track-title7
audio-player-icons-style-solid6
button-style-raised6
svgsocialbackground-colorrgba3434344sqs-slide-wrapperdata-slide-typelock-screen6
use-maskfillrgba3434344sqs-slide-wrapperdata-slide-typelock-screen6
sqs-slide-containerdata-slide-typepopup-overlayoverlay-alignment-left6
inputtypesubmitsqs-slide-wrapperdata-slide-typelock-screen6
audio-player-icons-style-border6
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-style-outline6
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-style-rectangle6
track-progress-bar6
input-wrapper6
sqs-slice-play-buttonicon-wrapperhover6
ulsqs-slide-wrapperdata-slide-typelock-screen6
social-icons-style-regular6
10px6
2em6
googlehover5
vimeohover5
googleplayhover5
houzzhover5
instagramhover5
imdbhover5
vscohover5
vevohover5
svgsocial-webkit-transitionbackground-color5
vinehover5
squarespacehover5
twitterhover5
stumbleuponhover5
smugmughover5
soundcloudhover5
6px5
rsshover5
spotifyhover5
reddithover5
rdiohover5
stitcherhover5
pinteresthover5
audio-player-icons-style-regular5
thedotshover5
meetuphover5
tidalhover5
mediumhover5
linkedinhover5
tumblrhover5
twitchhover5
ituneshover5
sqs-slice-album-playlistplaying5
facebookhover5
goodreadshover5
dribbblehover5
01s5
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-style-underlined5
buttonsqs-slide-wrapperdata-slide-typelock-screen5
sqs-slide-layer-content5
lock-style-regular5
applepodcasthover5
tweet-timestamp5
bandsintownhover5
behancehover5
githubhover5
use-maskfilltransparentsqs-slide-wrapperdata-slide-typelock-screen5
codepenhover5
button-shape-pill5
social-icons-style-knockout5
button-shape-rounded-corners5
gmnoprint5
fivehundredpixhover5
gm-style-cc5
youtubehover5
ease-outopacity5
flickrhover5
foursquarehover5
snapchathover5
100ms5
emailhover5
yelphover5
dropboxhover5
neuearialsans-seriffont-weightnormalfont-stylenormalletter-spacing6pxsqs-slide-wrapperdata-slide-typelock-screen4
form-itemsqs-slide-wrapperdata-slide-typelock-screen4
4px4
inputtypetext-moz-placeholdercolorrgba1631631635sqs-slide-wrapperdata-slide-typelock-screen4
video-icon-style-solid4
lock-style-border4
tweet-body4
autosqs-slide-wrapperdata-slide-typelock-screen4
icon-wrapperwidth24pxheight24pxmargin04
audio-player-icons-style-knockout4
use-iconfilltransparentsqs-slide-wrapperdata-slide-typelock-screen4
use-maskfillfffsqs-slide-wrapperdata-slide-typelock-screen4
displaytablesqs-slide-wrapperdata-slide-typelock-screen4
5px4
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabledbutton-style-raised4
map-style-minimal-dark4
ulstacked4
video-icon-style-regular4
track-title4
fffsqs-slide-wrapperdata-slide-typelock-screen3
social-icons-size-extra-largesocial-icons-style-solid3
lock-style-knockout3
icon-wrapperborder2px3
social-icons-size-extra-smallsocial-icons-style-regular3
autoflex13
video-icon-style-knockout3
use-iconfill000sqs-slide-wrapperdata-slide-typelock-screen3
14px3
arrow-icon3
easesqs-slide-wrapperdata-slide-typelock-screen3
inputtypepasswordsqs-slide-wrapperdata-slide-typelock-screen3
tweet-handle3
avisitedsqs-slide-wrapperdata-slide-typelock-screen3
social-icons-size-extra-largesocial-icons-style-knockout3
use-iconfill00b4b3sqs-slide-wrapperdata-slide-typelock-screen3
use-iconfill222background-color222sqs-slide-wrapperdata-slide-typelock-screen3
tweet-display-name3
use-iconfill1769ffsqs-slide-wrapperdata-slide-typelock-screen3
tweet-avatar3
sqs-modal-lightbox3
svgsocialbackground-colortransparentsqs-slide-wrapperdata-slide-typelock-screen3
buttontypesubmitsqs-slide-wrapperdata-slide-typelock-screen3
use-iconfillea4c89sqs-slide-wrapperdata-slide-typelock-screen3
use-iconfill007ee5sqs-slide-wrapperdata-slide-typelock-screen3
inputtypesubmithoversqs-slide-wrapperdata-slide-typelock-screen3
button-style-solid3
lock-style-solid3
icon-wrapperwidth36pxheight36pxmargin03
sqs-slide-containerdata-slide-typepopup-overlaybutton-layout-style-inline-auto3
error-messagesqs-slide-wrapperdata-slide-typelock-screen3
social-icons-size-largesocial-icons-style-regular3
responsive-wrapper3
sqs-slide-containerdata-slide-typepopup-overlayenable-overlay-content-border3
actionssqs-slide-wrapperdata-slide-typelock-screen3
8px3
social-icons-size-extra-largesocial-icons-style-regular3
sqs-slide-containerdata-slide-typepopup-overlayoverlay-load-animation-slide-in3
sqs-slidesqs-slide-animation-ready3
social-icons-size-extra-smallsocial-icons-style-border3
social-icons-size-extra-smallsocial-icons-style-knockout3
social-icons-size-extra-smallsocial-icons-style-solid3
social-icons-size-smallsocial-icons-style-border3
social-icons-size-smallsocial-icons-style-knockout3
social-icons-size-smallsocial-icons-style-solid3
adisplayblocksqs-slide-wrapperdata-slide-typelock-screen3
social-icons-size-mediumsocial-icons-style-border3
social-icons-size-mediumsocial-icons-style-knockout3
social-icons-size-mediumsocial-icons-style-solid3
sqs-slicedata-content-emptytruedisplaynonesqs-slide-wrapperdata-slide-typelock-screen3
social-icons-size-largesocial-icons-style-border3
5emfont14px3
field-errordisplayblockpositionabsolutebox-sizingborder-boxpadding25em3
social-icons-size-largesocial-icons-style-knockout3
responsive-wrappernotstacked3
social-icons-size-largesocial-icons-style-solid3
captcha-container-wrapper3
sqs-slide-containerdata-slide-typepopup-overlaybutton-style-outline3
social-icons-size-extra-largesocial-icons-style-border3
responsive-wrapperstackedtext-align-center3
sqs-slide-containerdata-slide-typepopup-overlaybutton-layout-style-inline3
sqs-slide-containerdata-slide-typepopup-overlaybutton-layout-style-auto3
use-iconfille0393esqs-slide-wrapperdata-slide-typelock-screen3
use-iconfille6b91esqs-slide-wrapperdata-slide-typelock-screen3
only3
use-iconfillff0031sqs-slide-wrapperdata-slide-typelock-screen3
use-iconfille4405fsqs-slide-wrapperdata-slide-typelock-screen3
sqs-slice-album-playliststacked3
use-iconfill55aceesqs-slide-wrapperdata-slide-typelock-screen3
use-iconfillec4652sqs-slide-wrapperdata-slide-typelock-screen3
sqs-slice-album-playlistdemo-album3
use-iconfill6441a5sqs-slide-wrapperdata-slide-typelock-screen3
icon-wrapperdiv-webkit-transformscale2-moz-transformscale2-ms-transformscale2transformscale2sqs-slide-wrapperdata-slide-typelock-screen3
use-iconfill0976b4sqs-slide-wrapperdata-slide-typelock-screen3
use-iconfill35465dsqs-slide-wrapperdata-slide-typelock-screen3
use-iconfill00ab6csqs-slide-wrapperdata-slide-typelock-screen3
button-play-pause3
screen3
use-iconfillcc2127sqs-slide-wrapperdata-slide-typelock-screen3
use-iconfill8c8070sqs-slide-wrapperdata-slide-typelock-screen3
3px3
use-iconfilleb4924sqs-slide-wrapperdata-slide-typelock-screen3
icon-wrapperwidth28pxheight28pxmargin03
use-iconfill006ed2sqs-slide-wrapperdata-slide-typelock-screen3
use-iconfill1ea9e1sqs-slide-wrapperdata-slide-typelock-screen3
use-iconfillff4500sqs-slide-wrapperdata-slide-typelock-screen3
social-icons-size-mediumsocial-icons-style-regular3
7px3
use-iconfill84bd00sqs-slide-wrapperdata-slide-typelock-screen3
icon-wrapperwidth32pxheight32pxmargin03
use-iconfill7dbb00sqs-slide-wrapperdata-slide-typelock-screen3
use-iconfill1ab7easqs-slide-wrapperdata-slide-typelock-screen3
use-iconfill7ac143sqs-slide-wrapperdata-slide-typelock-screen3
use-iconfillf60sqs-slide-wrapperdata-slide-typelock-screen3
1px3
data-slice-typebuttonssqs-slide-wrapperdata-slide-typelock-screen3
ease-in-outtransitioncolor3
ease-in-out-o-transitioncolor3
ease-in-out-ms-transitioncolor3
ease-in-out-moz-transitioncolor3
use-iconfill3b5998sqs-slide-wrapperdata-slide-typelock-screen3
use-iconfill0099e5sqs-slide-wrapperdata-slide-typelock-screen3
countdown-unit3
sqs-slice-custom-formsqs-slide-wrapperdata-slide-typelock-screen3
data-slice-typegallerysqs-gallery-grid3
sqs-slide-containernotauto-image-background-color3
disclaimer-containersqs-slide-wrapperdata-slide-typelock-screen3
use-iconfill0063dcsqs-slide-wrapperdata-slide-typelock-screen3
ease-in-moz-transitionopacity3
use-iconfill00b488sqs-slide-wrapperdata-slide-typelock-screen3
data-slice-typeheadingnotdata-compound-type3
ease-in-ms-transitionopacity3
ease-in-o-transitionopacity3
ease-intransitionopacity3
use-iconfillf94877sqs-slide-wrapperdata-slide-typelock-screen3
use-iconfille52d27sqs-slide-wrapperdata-slide-typelock-screen3
gallery-video-backgroundmobile3
use-iconfill4183c4sqs-slide-wrapperdata-slide-typelock-screen3
use-iconfillc41200sqs-slide-wrapperdata-slide-typelock-screen3
use-iconfill382110sqs-slide-wrapperdata-slide-typelock-screen3
use-iconfillae995asqs-slide-wrapperdata-slide-typelock-screen3
use-iconfill5adfcbsqs-slide-wrapperdata-slide-typelock-screen3
use-iconfilldc4e41sqs-slide-wrapperdata-slide-typelock-screen3
social-icons-size-smallsocial-icons-style-regular3

Who hosts Larazacrc.org?

Larazacrc.org Hosting Provider Information

Hosted IP Address:198.185.159.144
Hosted Hostname:198.185.159.144
Service Provider:Squarespace, Inc.
Hosted Country:United StatesUS
Location Latitude:40.7157
Location Longitude:-74
Webserver Software:Squarespace

Is "Squarespace, Inc." in the Top 10 Hosting Companies?

Name
Percentage
DoD Network Information Center
16.7387%
GoDaddy.com, LLC
8.5968%
Namecheap, Inc.
4.2653%
Confluence Networks Inc
2.7791%
Google Inc.
2.3954%
Merit Network Inc.
1.8799%
Fara Negar Pardaz Khuzestan
1.8361%
1&1 Internet AG
1.8274%
Amazon.com, Inc.
1.7814%
Cogent Communications
1.6096%
Squarespace, Inc.
1.5035%

HTTP Header Analysis for Larazacrc.org

Http-Version: 1.1
Status-Code: 301
Status: 301 Moved Permanently
date: Sun, 01 Nov 2020 04:41:37 GMT
location: https://www.larazacrc.org/
Age: 0
Transfer-Encoding: chunked
x-contextid: Ur3k3nzH/226rcMKz
server: Squarespace

Larazacrc.org Domain Nameserver Information

HostIP AddressCountry
ns1.okapi.arvixe.com 169.55.246.167
ns2.okapi.arvixe.com 108.168.166.90


Need to find out who hosts Larazacrc.org?


Domain Registration (WhoIs) information for Larazacrc.org

 Domain Name: LARAZACRC.ORG
Registry Domain ID: D104317724-LROR
Registrar WHOIS Server: whois.enom.com
Registrar URL: http://www.enom.com
Updated Date: 2020-04-22T08:08:08Z
Creation Date: 2004-05-07T17:15:59Z
Registry Expiry Date: 2021-05-07T17:15:59Z
Registrar Registration Expiration Date:
Registrar: eNom, Inc.
Registrar IANA ID: 48
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.4252982646
Reseller:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registrant Organization: Whois Privacy Protection Service, Inc.
Registrant State/Province: WA
Registrant Country: US
Name Server: NS1.OKAPI.ARVIXE.COM
Name Server: NS2.OKAPI.ARVIXE.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form https://www.icann.org/wicf/)
>>> Last update of WHOIS database: 2020-06-06T19:59:30Z

Websites with Similar Names

Laraza.co.uk
La Raza | Tapas Restaurant, Cocktail Bar and Café, Cambridge UK
Laraza.com
La Raza | Últimas Noticias en Español de Chicago, USA, y El Mundo
Laraza.com.mx
Web user login
Laraza.fm
.:: LA RAZA::.
Laraza105.com
Laraza105.com
Laraza900.com
Radio La Raza 900 AM
Larazaathleticassociation.com
larazaathleticassociation.com -&nbsplarazaathleticassociation Resources and Information.

Recently Updated Websites

Tymba.org.uk (1 second ago.)Programmingplanet.org (2 seconds ago.)Runnerinyou.us (2 seconds ago.)Reussirsonwebmarketing.com (2 seconds ago.)Popartposters.org (3 seconds ago.)Mobileappcss.com (3 seconds ago.)Prisedetete.website (3 seconds ago.)Livingbalancedleadership.com (4 seconds ago.)Durhamurbanliving.com (5 seconds ago.)Stationcountry.com (5 seconds ago.)Gpgcberinag.org (5 seconds ago.)Empoweredwellnessnc.com (5 seconds ago.)Dreamyfit.com (5 seconds ago.)Islambeacon.com (5 seconds ago.)Aquamundis.com (6 seconds ago.)Paddingtonhomes.com (6 seconds ago.)Tenzingtravel.nl (6 seconds ago.)Panacafetours.com (7 seconds ago.)Renzograciebocaraton.com (8 seconds ago.)Ganool.net (8 seconds ago.)Southhillrent.com (8 seconds ago.)Romantikrebel.com (8 seconds ago.)Teabulous.com (8 seconds ago.)Roycerealestate.net (8 seconds ago.)Okinawa.best (8 seconds ago.)Virtualboy.xyz (8 seconds ago.)Gamedevs.org (8 seconds ago.)Entre-isles-et-nous.com (9 seconds ago.)Afrosandhightea.com (9 seconds ago.)Pshenisnov.ru (9 seconds ago.)

Recently Searched Keywords

tt快三计划 外媒:受疫情冲击 (1 second ago.)dataset (2 seconds ago.)arnill (6 seconds ago.)que preciso rapidamente (7 seconds ago.)we provide on-demand (8 seconds ago.)đau bụng dưới rốn là dấu hiệu của bệnh lý gì, có nguy hiểm không (8 seconds ago.)actualmente es (10 seconds ago.)哲学 (12 seconds ago.)afficher tous (12 seconds ago.)kdv kdv (16 seconds ago.)dubaiorder food online (19 seconds ago.)next level 5013 (20 seconds ago.)clean beauty (21 seconds ago.)кофеварка рожковая oursson em1505 отзывы (22 seconds ago.)kitchenstewardship (25 seconds ago.)watchconsentfunction canuse canusetwitter (28 seconds ago.)event details (31 seconds ago.)ey yoktur sadece (32 seconds ago.)tdmodulewrapnth-last-child-n4margin-bottom0importantpadding-bottom0importanttdi851a (33 seconds ago.)qut lm thy (34 seconds ago.)qmu93 (38 seconds ago.)try another (39 seconds ago.)sanssans-serif--itemdescriptionfontcolorslideshow 181717colorrgb24 23 (42 seconds ago.)voip hardwares (45 seconds ago.)zu den kursen (46 seconds ago.)maini cu arbore (49 seconds ago.)getscrolltop (49 seconds ago.)ankara aydınlatma ürünleri (50 seconds ago.)52xiachu (51 seconds ago.)census bureau making (52 seconds ago.)