It's all about Dogs - Leadchanges

Safety: Low trust score
Year Founded: 2013
Global Traffic Rank: Unknown
Estimated Worth: $9
Category: This site has not been categorized yet



Domain summary

Last updated
2020-10-30
Domain label
leadchanges
Domain extension
net
Domain registered:
2013-03-26
Domain updated:
2019-08-21
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is leadchanges.net ranked relative to other sites:

Percentage of visits to leadchanges.net from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Leadchanges.net registered?
A: Leadchanges.net was registered 8 years, 1 month, 3 weeks, 1 day, 19 hours, 57 minutes, 57 seconds ago on Tuesday, March 26, 2013.
Q: When was the WHOIS for Leadchanges.net last updated?
A: The WHOIS entry was last updated 1 year, 8 months, 3 weeks, 6 days, 19 hours, 57 minutes, 57 seconds ago on Wednesday, August 21, 2019.
Q: What are Leadchanges.net's nameservers?
A: DNS for Leadchanges.net is provided by the following nameservers:
  • ns1.stackdns.com
  • ns2.stackdns.com
  • ns3.stackdns.com
  • ns4.stackdns.com
Q: Who is the registrar for the Leadchanges.net domain?
A: The domain has been registered at TUCOWS DOMAINS INC..
Q: What is the traffic rank for Leadchanges.net?
A: Leadchanges.net has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Leadchanges.net each day?
A: Leadchanges.net receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Leadchanges.net resolve to?
A: Leadchanges.net resolves to the IPv4 address 185.151.30.135.
Q: In what country are Leadchanges.net servers located in?
A: Leadchanges.net has servers located in the United Kingdom.
Q: What webserver software does Leadchanges.net use?
A: Leadchanges.net is powered by webserver.
Q: Who hosts Leadchanges.net?
A: Leadchanges.net is hosted by Fara Negar Pardaz Khuzestan in United Kingdom.
Q: How much is Leadchanges.net worth?
A: Leadchanges.net has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Leadchanges.net Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Leadchanges.net Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Leadchanges.net

H1 Headings

0 :

H2 Headings

13 :
  1. It's all about dogs...
  2. Covid-19
  3. Iwona Wightman
  4. Philomena and Lil Spud, Spain
  5. Kat with Bailey and Lexi
  6. Mick and Kerry & Luna, Norwich
  7. Helen – Wymondham
  8. Scott & Hector, Ipswich
  9. Keirsten – Saffron Walden
  10. Jane and Ellis – with Maisie
  11. Glyn & Nelson
  12. Tracie and Basil
  13. Affiliations

H3 Headings

2 :
  1. WHAT PEOPLE THINK
  2. QUALIFICATIONS & AFFILIATIONS

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

16 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-91343418-1

Links - Internal

22:

Links - Internal (nofollow)

0:

Links - Outbound

8:

Links - Outbound (nofollow)

0:

Keyword Cloud for Leadchanges.net

topleadchanges 5hectoravailableleadchangeswereexerciseslearnenough shelunamaisiesanyonexsetstarneedvideonottamasine enoughdog behaviourstar bark reviewmodificationenvironmenthomedogs i havethereoldtheyhasbutoverfurtherjusttookrecommend tamasineher stuffyourusfirstdoghadleadchanges dog behaviourfullreview tamasinecannotcant thank tamasinelabradorotherdifferenceany questionshavehisenoughfacebookgoodbark reviewthank tamasine enoughwouldlil spudbegancertainly5 star barkhernelsonemailgivetwoamall5 starcantshecontactlovelyreviewsknows heremailed1recommend038itselffive star reviewspersonknowledgeoutsidesteptrainingupwellpuppywhichpatientknows her stuffnotesfive starbarkmadeusingnowdoingour firstmaisiecalmtooreally2morespudprogrammefivehetamasineworkcant thankbeforesomeguidancefriendlymaisies behaviourneededsitbark review tamasinewolfhoundanynotimeset updogsongoingstillmelilhelpinggotmy dogsreviewconcernsafterthroughhighlyhappyhome visitveryfantasticaskednervousfeelquestions welotsbehaviour modificationgoogleonlyvery patientsupportwe havegetmayquestionskeepevenwhatsappbehaviourwethank tamasinehelphimalwaysthankalreadyprofessionalyou0basilstrugglesessiongoimportantwe beganoutbrilliantintoadvicesocanknowsleadchanges dogyour dogstar barkvisitprovidedmymuchstuffconfidencestar reviewsoursawthingscomeinformationvisitsdo

Longtail Keyword Density for Leadchanges.net

KeywordsOccurences
5 star bark10
star bark review8
bark review tamasine6
dogs i have4
knows her stuff4
cant thank tamasine4
thank tamasine enough4
five star reviews3
leadchanges dog behaviour3
5 star12
bark review10
star bark10
leadchanges 59
we have6
tamasine enough6
review tamasine6
your dog5
home visit4
questions we4
any questions4
we began4
our first4
thank tamasine4
cant thank4
her stuff4
maisies behaviour4
knows her4
set up4
very patient4
my dogs4
enough she4
recommend tamasine4
behaviour modification3
dog behaviour3
leadchanges dog3
star reviews3
five star3
lil spud3
we41
tamasine37
her28
she28
our23
022
have22
us21
dog20
dogs18
he18
review16
leadchanges16
star15
but14
him14
very14
help14
me13
bark13
more12
you12
behaviour11
session11
some10
so9
support9
do9
can9
home9
puppy9
your9
just9
after8
now8
enough8
my8
up8
first8
no8
not8
really7
training7
still7
had7
all7
calm7
time7
his6
knows6
old6
questions6
highly6
made6
before6
nervous6
always6
cannot6
am6
work6
contact6
two6
well6
confidence6
go6
has6
any6
thank6
out6
nelson5
hector5
through5
professional5
15
feel5
much5
basil5
google5
get5
over5
person5
using5
guidance5
wolfhound4
top4
stuff4
there4
friendly4
cant4
0384
knowledge4
certainly4
24
would4
saw4
need4
labrador4
programme4
lots4
advice4
visit4
got4
email4
emailed4
good4
took4
whatsapp4
happy4
into4
began4
maisies4
information4
step4
brilliant4
recommend4
concerns4
already4
come4
outside4
fantastic4
visits4
video4
set4
too4
were4
needed4
difference4
things4
sit4
asked4
which4
keep4
lovely4
patient4
environment3
itself3
give3
even3
anyone3
exercises3
they3
important3
other3
available3
maisie3
may3
ongoing3
struggle3
modification3
spud3
luna3
lil3
x3
facebook3
full3
reviews3
helping3
five3
provided3
notes3
only3
doing3
learn3
further3

Who hosts Leadchanges.net?

Leadchanges.net Hosting Provider Information

Hosted IP Address:185.151.30.135
Hosted Hostname:185-151-30-135.ptr4.stackcp.net
Service Provider:Fara Negar Pardaz Khuzestan
Hosted Country:United KingdomGB
Location Latitude:51.4964
Location Longitude:-0.1224
Webserver Software:Not Applicable

Is "Fara Negar Pardaz Khuzestan" in the Top 10 Hosting Companies?

Name
Percentage
DoD Network Information Center
15.7948%
GoDaddy.com, LLC
8.0700%
Namecheap, Inc.
4.0119%
Confluence Networks Inc
2.6770%
Fara Negar Pardaz Khuzestan
2.1305%
Google Inc.
2.1184%
Merit Network Inc.
1.8272%
1&1 Internet AG
1.8076%
Cogent Communications
1.7178%
CloudFlare, Inc.
1.6296%

HTTP Header Analysis for Leadchanges.net

Http-Version: 1.1
Status-Code: 301
Status: 301 Moved Permanently
date: Fri, 30 Oct 2020 13:47:35 GMT
content-length: 0
location: https://leadchanges.net/
x-cdn-cache-status: MISS
x-via: LON2

Leadchanges.net Domain Nameserver Information

HostIP AddressCountry
ns1.stackdns.com 35.197.225.59
ns2.stackdns.com 146.148.28.88
ns3.stackdns.com 35.198.79.191
ns4.stackdns.com 104.196.137.209


Need to find out who hosts Leadchanges.net?


Domain Registration (WhoIs) information for Leadchanges.net

 Domain Name: LEADCHANGES.NET
Registry Domain ID: 1789202146_DOMAIN_NET-VRSN
Registrar WHOIS Server: whois.tucows.com
Registrar URL: http://www.tucows.com
Updated Date: 2019-08-21T17:06:11Z
Creation Date: 2013-03-26T18:09:46Z
Registry Expiry Date: 2021-03-26T18:09:46Z
Registrar: Tucows Domains Inc.
Registrar IANA ID: 69
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Name Server: NS1.STACKDNS.COM
Name Server: NS2.STACKDNS.COM
Name Server: NS3.STACKDNS.COM
Name Server: NS4.STACKDNS.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2020-08-31T09:38:08Z

Websites with Similar Names

Leadcabin.com
HugeDomains.com
Leadcaesar.com
Lead Caesar - Lead Generation & Affiliate Network
Leadcafe.jp
家の防犯対策はされていますか?
Leadcall.com.br
Transforme mais visitantes em vendas
Leadcallback.net
Connecting...

Recently Updated Websites

College-sport.us (1 second ago.)Teddyjj.com (1 second ago.)Outstandingbrieftowitness-today.info (3 seconds ago.)Scallystr8lads.tumblr.com (4 seconds ago.)Sauce.biz (5 seconds ago.)Modna-kolekcja.pl (5 seconds ago.)Regencyvapor.com (6 seconds ago.)Golfcartac.com (6 seconds ago.)Ography2.com (8 seconds ago.)Yourenotspecial.us (8 seconds ago.)Chinahelpguide.com (8 seconds ago.)Catdema.cat (9 seconds ago.)Wokecook.com (9 seconds ago.)Screwedmusic.info (9 seconds ago.)Tyyynk.com (9 seconds ago.)Redinnovations.com.br (9 seconds ago.)Motherswithfourthdegreetears.org (10 seconds ago.)Hanbord.com (10 seconds ago.)Wpicons.com (10 seconds ago.)Houseofgoodlife.com (10 seconds ago.)Openkio.com (10 seconds ago.)Markaysyorkies.com (10 seconds ago.)Artnailmarianna.com (11 seconds ago.)Americanmarineinc.com (11 seconds ago.)Dezgarant-almaty.kz (12 seconds ago.)Tipiscout.com (12 seconds ago.)Jjb101.com (14 seconds ago.)Mapping-nature.org (14 seconds ago.)Safehavenadvocatepetcare.com (14 seconds ago.)Lnts.com (14 seconds ago.)

Recently Searched Keywords

deutsche vermgensberatung (1 second ago.)khama billiat (2 seconds ago.)casadei (2 seconds ago.)real estate school (4 seconds ago.)sostenibilidad (4 seconds ago.)haas grotesk (4 seconds ago.)polyvalent (7 seconds ago.)03-27 (7 seconds ago.)22.02.2015 fc kehlen - green boys 2:0 (1:0) (8 seconds ago.)hobmodels (8 seconds ago.)likes (10 seconds ago.)bewanted colombia (10 seconds ago.)seller dashboard (11 seconds ago.)labri de piscine (11 seconds ago.)annunci (12 seconds ago.)link encuestas para levantamiento de informaciã³n cursos prã¡cticos ene-mar 2021 (13 seconds ago.)3tstq (16 seconds ago.)últimas noticias (18 seconds ago.)tristar engineering (20 seconds ago.)google domains (21 seconds ago.)công ty du lịch khát vọng việt mua lại thương hiệu và website toursimshikoku.org (23 seconds ago.)memberikan (24 seconds ago.)510 0 (25 seconds ago.)investigations inc (25 seconds ago.)stresscheck software (26 seconds ago.)vehicle others (27 seconds ago.)dota2雷竞技 (28 seconds ago.)julkula – att smycka julgranen med vackra prydnader (30 seconds ago.)0:38 ما هي الأشكال الجميلة التي تملكها هذه المرأة بدون ملابس؟ (30 seconds ago.)ungarn (31 seconds ago.)