Fackförbundet Ledarna – Sveriges chefsorganisation | Ledarna

Safety: Low trust score
Year Founded: 1995
Global Traffic Rank: 732,664
Estimated Worth: $1,680

Hos fackförbundet Ledarna – Sveriges chefsorganisation – finns allt som rör din chefsroll och ditt ledarskap. Hos oss blir du en bättre chef. Välkommen!



Domain summary

Last updated
2021-06-05
Domain label
ledarna
Domain extension
se
Domain registered:
1995-02-09
Domain updated:
2021-06-05
Domain expires:
2021-12-31
Global Traffic Rank
732,664
Statvoo Rating
H
Trust Score
Low Trust Score
Estimated worth
$1,680
Estimated daily income
$7
Estimated monthly income
$213

Frequently Asked Questions (FAQ)

Q: When was Ledarna.se registered?
A: Ledarna.se was registered 26 years, 7 months, 2 weeks, 4 days, 4 hours, 41 minutes, 50 seconds ago on Thursday, February 9, 1995.
Q: When was the WHOIS for Ledarna.se last updated?
A: The WHOIS entry was last updated 3 months, 3 weeks, 1 day, 4 hours, 41 minutes, 50 seconds ago on Saturday, June 5, 2021.
Q: What are Ledarna.se's nameservers?
A: DNS for Ledarna.se is provided by the following nameservers:
  • dns1.telenor.se
  • dns2.telenor.se
Q: Who is the registrar for the Ledarna.se domain?
A: The domain has been registered at NIC-SE.
Q: What is the traffic rank for Ledarna.se?
A: Ledarna.se ranks 732,664 globally on Alexa. Ledarna.se has a Low Trust Score, and a Statvoo Rank of H.
Q: How many people visit Ledarna.se each day?
A: Ledarna.se receives approximately 1,189 visitors and 2,378 page impressions per day.
Q: What IP address does Ledarna.se resolve to?
A: Ledarna.se resolves to the IPv4 address 213.179.28.121.
Q: In what country are Ledarna.se servers located in?
A: Ledarna.se has servers located in the Sweden.
Q: What webserver software does Ledarna.se use?
A: Ledarna.se is powered by Microsoft-IIS/10.0 webserver.
Q: Who hosts Ledarna.se?
A: Ledarna.se is hosted by QD Sverige AB in Stockholm County, Stockholm, Sweden, 131 29.
Q: How much is Ledarna.se worth?
A: Ledarna.se has an estimated worth of $1,680. An average daily income of approximately $7, which is roughly $213 per month.

Ledarna.se Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Ledarna.se Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Ledarna.se

H1 Headings

1 :
  1. Hos oss blir du en bättre chef.

H2 Headings

9 :
  1. Kanske letar du efter mer information om...
  2. Lönestatistik för chefer
  3. Bli medlem Ansök om medlemskap
  4. Nytt jobb Lediga chefsjobb i hela landet
  5. Chefsblogg Åsikter och tankar i aktuella ämnen
  6. Ledarna Fackförbundet för dig som är chef
  7. Nyheter från Ledarna
  8. Nyheter från tidningen Chef.
  9. 0200-87 11 11

H3 Headings

3 :
  1. Frågor och svar angående coronaviruset covid-19
  2. Kontakt
  3. Följ Ledarna

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

22 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

33:

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Ledarna.se

ochsvarnewslistblock linkcontainersecondarysdunewslistblock linkcontainer newslistblockcoronavirusetnewslistblockmedlemskaphoschefseomoch svartillnonelinkcontainersecondary display noneintedigf246rcoronaviruset covid19newslistblock linkcontainerst228nglinkcontainersecondary displayavchefmedlemdisplayparings246kdisplay nonevarmerchefer0flerledarnasesom chefvilinkcontainer newslistblocksverigesledarnaattcovid19linkcontainermedlinkcontainer newslistblock linkcontainersecondarynyheterp229dig somsomsenewslistblock linkcontainersecondary displaylinkcontainersecondaryfoumlrfoumlr chefer

Who hosts Ledarna.se?

Ledarna.se Hosting Provider Information

Hosted IP Address:213.179.28.121
Hosted Hostname:www.ledarna.se
Service Provider:QD Sverige AB
Hosted Country:SwedenSE
Location Latitude:59.3274
Location Longitude:18.0653
Webserver Software:Microsoft-IIS/10.0

Is "QD Sverige AB" in the Top 10 Hosting Companies?

Name
Percentage
GOOGLE
17.4810%
Unknown
8.7814%
AS-26496-GO-DADDY-COM-LLC
4.6042%
NAMECHEAP-NET
3.7023%
AMAZON-AES
2.7678%
GoDaddy.com, LLC
2.4095%
UNIFIEDLAYER-AS-1
2.4018%
Fara Negar Pardaz Khuzestan
2.0303%
CONFLUENCE-NETWORK-INC
1.7535%
1&1 Internet AG
1.6915%
QD Sverige AB
0.0000%

HTTP Header Analysis for Ledarna.se

Http-Version: 1.1
Status-Code: 200
Status: 200
cache-control: private
content-type: text/html; charset=utf-8
content-encoding: gzip
vary: Accept-Encoding
server: Microsoft-IIS/10.0
x-aspnetmvc-version: 5.2
x-aspnet-version: 4.0.30319
x-powered-by: ASP.NET
date: Sat, 05 Jun 2021 12:37:41 GMT
content-length: 15640

Ledarna.se Domain Nameserver Information

HostIP AddressCountry
dns1.telenor.se 213.150.135.213Sweden Sweden
dns2.telenor.se 213.150.128.30Sweden Sweden


Need to find out who hosts Ledarna.se?


Domain Registration (WhoIs) information for Ledarna.se

 # Copyright (c) 1997- The Swedish Internet Foundation.
# All rights reserved.
# The information obtained through searches, or otherwise, is protected
# by the Swedish Copyright Act (1960:729) and international conventions.
# It is also subject to database protection according to the Swedish
# Copyright Act.
# Any use of this material to target advertising or
# similar activities is forbidden and will be prosecuted.
# If any of the information below is transferred to a third
# party, it must be done in its entirety. This server must
# not be used as a backend for a search engine.
# Result of search for registered domain names under
# the .se top level domain.
# This whois printout is printed with UTF-8 encoding.
#
state: active
domain: ledarna.se
holder: italed2850-00001
admin-c: -
tech-c: -
billing-c: -
created: 1995-02-09
modified: 2020-12-01
expires: 2021-12-31
transferred: 2009-11-18
nserver: dns1.telenor.se
nserver: dns2.telenor.se
dnssec: unsigned delegation
registry-lock: unlocked
status: ok
registrar: Loopia AB

Websites with Similar Names

Ledar-tech.com
LEDAR TECH CO., LTD,
Ledarabul.net
ledarabul.net Premium Park Sayfası
Ledarabul.xyz
ledarabul.xyz Premium Park Sayfası
Ledaracplakasi.com
ledaracplakasi.com | Ücretsiz yapım aşamasında sayfası
Ledaracplakasi.xyz
ledaracplakasi.xyz | Ücretsiz yapım aşamasında sayfası
Ledarb.com
LeDarb - L’ecommerce de la commande groupée
Ledarbetesettur.com
ledarbetesettur.com
Ledarcba.com
LEDCBA CÓRDOBA VENTAS POR MENOR Y MAYOR - Tecnología LED Multi Marcas - Inicio

Recently Updated Websites

Whileathome.us (5 seconds ago.)Tibeb-leather-works.com (9 seconds ago.)Refined-artisan.com (11 seconds ago.)Transformmdspa.com (11 seconds ago.)Salsaselcuate.com (12 seconds ago.)Bot500.com (16 seconds ago.)Krnxbox.com (17 seconds ago.)It-zimmermann-net.de (17 seconds ago.)Javidol.org (22 seconds ago.)Theofficemanagerschampion.com (24 seconds ago.)Nctltq.com (25 seconds ago.)Kaezarimmobilier.com (26 seconds ago.)Rumirecords.com (32 seconds ago.)Bornrich191.com (36 seconds ago.)Brandwithpurposebook.com (37 seconds ago.)Stucharno.com (37 seconds ago.)Look-with-love.com (39 seconds ago.)Njqas.com (40 seconds ago.)Citascitables.com.ar (40 seconds ago.)Howcanihelpleaders.com (42 seconds ago.)Babkabite.com (43 seconds ago.)Justkitten.org (45 seconds ago.)5bigveggieballs.org (46 seconds ago.)Access.education (49 seconds ago.)Suffolkcountymmj.net (51 seconds ago.)Wisdom.to (53 seconds ago.)Teachinhome.com (53 seconds ago.)Selectorcorp.com (55 seconds ago.)Signifiq.com (56 seconds ago.)Webflowing.net (1 minute 2 seconds ago.)

Recently Searched Keywords

анализы на дому (1 second ago.)ali karahasanoğlu ali karahasanoğlu 18 mart 2021 hdp 2019’da, kendisini zaten kapatmıştı! (2 seconds ago.)25px 0 (5 seconds ago.)бог-любовь и существование зла в мире (5 seconds ago.)border-bottom-right-radius0 -moz-box-shadow 0 (8 seconds ago.)spandan.indianoil.co.in login (8 seconds ago.)400mg (8 seconds ago.)0cart (9 seconds ago.)ebony (10 seconds ago.)ralit (10 seconds ago.)newsbitcoin.cash (13 seconds ago.)newsbitcoin.cash (13 seconds ago.)нить st 5040 san-lock l=50m полиамидная пропитанная силиконом (14 seconds ago.)homes display (14 seconds ago.)responsive-wrapperstackedtext-align-center (15 seconds ago.)wall (15 seconds ago.)you to get (16 seconds ago.)academia corpo e saude taguatinga norte qnd (17 seconds ago.)bid 800 (17 seconds ago.)статья 21. особенности согласования проекта схемы территориального планирования муниципального района (17 seconds ago.)znqg (18 seconds ago.)podstawie (18 seconds ago.)статья 21. особенности согласования проекта схемы территориального планирования муниципального района (19 seconds ago.)video review (20 seconds ago.)yaza veda pikniğimiz (21 seconds ago.)матеріали для монтажу та обслуговування систем (21 seconds ago.)3p极品外围空姐,情趣黑丝前后夹击好淫荡 (21 seconds ago.)статья 21. особенности согласования проекта схемы территориального планирования муниципального района (22 seconds ago.)currentseconds (23 seconds ago.)read more healthy (23 seconds ago.)