LEXCON - Zakładanie Spółek, Prawnik, Adwokat, Kancelaria Prawna Wrocław - strona główna

Safety: Low trust score
Year Founded: 2021
Global Traffic Rank: Unknown
Estimated Worth: $9
Category: This site has not been categorized yet

Lexcon Sp. z o.o. jest polską kancelarią, świadczącą kompleksowe usługi prawne dla klientów korporacyjnych i indywidualnych zarówno na etapie przedsądowym jak i w postępowaniach przed sądami.



Domain summary

Last updated
2021-06-17
Domain label
lexcon
Domain extension
pl
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Frequently Asked Questions (FAQ)

Q: When was Lexcon.pl registered?
A: Lexcon.pl was registered 1 month, 1 week, 5 days, 14 hours, 45 minutes, 51 seconds ago on Thursday, June 17, 2021.
Q: When was the WHOIS for Lexcon.pl last updated?
A: The WHOIS entry was last updated 1 month, 1 week, 5 days, 14 hours, 45 minutes, 51 seconds ago on Thursday, June 17, 2021.
Q: What are Lexcon.pl's nameservers?
A: DNS for Lexcon.pl is provided by the following nameservers:
  • dns.home.pl
  • dns2.home.pl
  • dns3.home.pl
Q: Who is the registrar for the Lexcon.pl domain?
A: The domain has been registered at NASK.
Q: What is the traffic rank for Lexcon.pl?
A: Lexcon.pl has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Lexcon.pl each day?
A: Lexcon.pl receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Lexcon.pl resolve to?
A: Lexcon.pl resolves to the IPv4 address 89.161.161.175.
Q: In what country are Lexcon.pl servers located in?
A: Lexcon.pl has servers located in the Poland.
Q: What webserver software does Lexcon.pl use?
A: Lexcon.pl is powered by IdeaWebServer/2.1.0 webserver.
Q: Who hosts Lexcon.pl?
A: Lexcon.pl is hosted by home.pl S.A. in Poland.
Q: How much is Lexcon.pl worth?
A: Lexcon.pl has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Lexcon.pl Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Lexcon.pl Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Lexcon.pl

H1 Headings

5 :
  1. Kancelaria Prawna Lexcon - profesjonalna obsługa prawna dla firm i instytucji
  2. Prawnicy
  3. Windykacja
  4. Usługi Prawne - oferta
  5. Opinie klientĂłw

H2 Headings

0 :

H3 Headings

1 :
  1. Kancelaria Lexcon Sp. z. o.o.

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

55 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-28212123-1

Links - Internal

26:

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Lexcon.pl

polecamwicejnbspnbspraquodowspkipakietprawnaklientwkontaktraquozlexconkancelaria lexconzaobsuga prawnabardzoobsugadlazakadaniefirmkancelariawypadekprzytwojejsprawusugispekwrocawsi

Who hosts Lexcon.pl?

Lexcon.pl Hosting Provider Information

Hosted IP Address:89.161.161.175
Hosted Hostname:cloudserver028877.home.pl
Service Provider:home.pl S.A.
Hosted Country:PolandPL
Location Latitude:52.2394
Location Longitude:21.0362
Webserver Software:IdeaWebServer/2.1.0

Is "home.pl S.A." in the Top 10 Hosting Companies?

Name
Percentage
GOOGLE
17.2088%
Unknown
5.0138%
AS-26496-GO-DADDY-COM-LLC
4.3256%
NAMECHEAP-NET
3.6268%
AMAZON-AES
2.7254%
GoDaddy.com, LLC
2.4825%
UNIFIEDLAYER-AS-1
2.3319%
Fara Negar Pardaz Khuzestan
1.9947%
CONFLUENCE-NETWORK-INC
1.7092%
1&1 Internet AG
1.6708%
home.pl S.A.
0.0676%

HTTP Header Analysis for Lexcon.pl

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Thu, 17 Jun 2021 09:21:53 GMT
Content-Type: text/html
Transfer-Encoding: chunked
Connection: keep-alive
Server: IdeaWebServer/2.1.0
Content-Encoding: gzip

Lexcon.pl Domain Nameserver Information

HostIP AddressCountry
dns.home.pl 217.160.80.244
dns2.home.pl 217.160.81.248
dns3.home.pl 217.160.82.251


Need to find out who hosts Lexcon.pl?


Domain Registration (WhoIs) information for Lexcon.pl

 request limit exceeded 

Websites with Similar Names

Lexcoast.com
Furniture West
Lexcoc.com
Lexington Area Chamber of Commerce
Lexcocable.com
Wire Rope Assemblies Manufacturer - Aircraft Cable, Fittings & More | Lexco Cable
Lexcochoralsoc.org
LEXINGTON COUNTY CHORAL SOCIETY (LCCS)

Recently Updated Websites

Privatemover.com (10 seconds ago.)Yuluo.org (11 seconds ago.)Healthandwealth.life (13 seconds ago.)Skymedia.mn (13 seconds ago.)Partymobileutah.com (15 seconds ago.)Rentacar-sochi.ru (16 seconds ago.)Oregonplatypus.com (18 seconds ago.)Sanidadivina.org (23 seconds ago.)G5uk.com (25 seconds ago.)You-will-grow.net (33 seconds ago.)Japaneseskincare.com.au (35 seconds ago.)Cable-land.net (35 seconds ago.)Windsorsmithhome.com (36 seconds ago.)Diversityjobsalerts.com (38 seconds ago.)Hotelaubonaccueil.com (40 seconds ago.)Cr3hperu.com (41 seconds ago.)Londontickets.com (45 seconds ago.)Uptoyoueducacion.com (48 seconds ago.)Lukaszuk.ca (50 seconds ago.)Yoouper.com (55 seconds ago.)Riseprevention.com (55 seconds ago.)Mvadventurecamp.com (56 seconds ago.)Lacasacucina.com (59 seconds ago.)Zwgjpx.com (59 seconds ago.)Marionartandbeauty.com (1 minute 1 second ago.)Avscleaner.com (1 minute 5 seconds ago.)Amlerassociates.com (1 minute 6 seconds ago.)Imagenpersonal.cl (1 minute 8 seconds ago.)Artistcaregiver.com (1 minute 10 seconds ago.)Onshoreoffshore.com (1 minute 10 seconds ago.)

Recently Searched Keywords

satelitales-3bwave (3 seconds ago.)tick capitulum (4 seconds ago.)plastic molded part (4 seconds ago.)golowka (4 seconds ago.)midcoast health emergency (6 seconds ago.)aids unitron (9 seconds ago.)军事天地 (10 seconds ago.)html bodycssvisibility (13 seconds ago.)sensex nifty (13 seconds ago.)diamondexchange.com login (16 seconds ago.)20-03 43rd street (17 seconds ago.)instant shipping containers (18 seconds ago.)select2-container (20 seconds ago.)ckyc (21 seconds ago.)carolyn (21 seconds ago.)solid transparentborder-left5px (22 seconds ago.)ipad parental control (22 seconds ago.)spgft (23 seconds ago.)斯诺克 (24 seconds ago.)dn mua hng (28 seconds ago.)ease-in-outimportant phonering-alo-phonephonering-alo-static (28 seconds ago.)ẩm thực quốc tế (29 seconds ago.)aleja svetog save 48, (29 seconds ago.)khch c (30 seconds ago.)phonering-alo-circle-anim 0 -webkit-transformrotate0 (31 seconds ago.)loại chuỗi cẩm thạch (32 seconds ago.)joe (32 seconds ago.)bizdock (33 seconds ago.)web kem trắng da thanh thảo (33 seconds ago.)195px 05 (33 seconds ago.)