Digitala marknadsföringsverktyg för företag | Liana Technologies

Safety: Low trust score
Year Founded: 2015
Global Traffic Rank: Unknown
Estimated Worth: $9
Category: This site has not been categorized yet

Behov av ett effektivare marknadsföringsverktyg till ditt företag? Liana Technologies erbjuder en komplett lösning för all din marknadsföring, kommunikation och PR



Domain summary

Last updated
2021-07-22
Domain label
lianatech
Domain extension
se
Domain registered:
2015-04-08
Domain updated:
2021-07-22
Domain expires:
2022-04-08
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Frequently Asked Questions (FAQ)

Q: When was Lianatech.se registered?
A: Lianatech.se was registered 6 years, 3 months, 3 weeks, 2 days, 2 hours, 5 minutes, 20 seconds ago on Wednesday, April 8, 2015.
Q: When was the WHOIS for Lianatech.se last updated?
A: The WHOIS entry was last updated 1 week, 3 days, 2 hours, 5 minutes, 20 seconds ago on Thursday, July 22, 2021.
Q: What are Lianatech.se's nameservers?
A: DNS for Lianatech.se is provided by the following nameservers:
  • ns1.viidakko.fi
  • ns2.viidakko.fi
  • ns3.viidakko.net
  • ns4.viidakko.net
Q: Who is the registrar for the Lianatech.se domain?
A: The domain has been registered at NIC-SE.
Q: What is the traffic rank for Lianatech.se?
A: Lianatech.se has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Lianatech.se each day?
A: Lianatech.se receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Lianatech.se resolve to?
A: Lianatech.se resolves to the IPv4 address .
Q: In what country are Lianatech.se servers located in?
A: Lianatech.se has servers located in the .
Q: What webserver software does Lianatech.se use?
A: Lianatech.se is powered by Nginx webserver.
Q: Who hosts Lianatech.se?
A: Lianatech.se is hosted by Unknown in .
Q: How much is Lianatech.se worth?
A: Lianatech.se has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Lianatech.se Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Lianatech.se Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Lianatech.se

H1 Headings

1 :
  1. Behov av effektivare marknadsföringsverktyg till ditt företag?

H2 Headings

9 :
  1. Liana®Cloud - Ett verktyg för digital marknadsföring, PR & kommunikation
  2. Liana loves marketers
  3. Fler än 3500 kunder världen över
  4. Blogg
  5. Effektiv eventkommunikation med Marketing Automation – 6 steg för att automatisera hybrida- och online-evenemang [infographic]
  6. 7 tips för en grym call-to-action
  7. 10 marknadsföringstrender för 2021 [video]
  8. Pressmeddelanden
  9. Vad är nytt inom digital marknadsföring?

H3 Headings

10 :
  1. Epostmarknadsföring
  2. Marketing Automation
  3. PR & Media
  4. Webbsida & Mobil
  5. E-handel
  6. Medvetenhet
  7. Utvärdering
  8. Köpbeslut
  9. Lojal kund
  10. Analys, bevakning och marketing automation

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

37 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

103:

Links - Internal (nofollow)

0:

Links - Outbound

23:

Links - Outbound (nofollow)

0:

Keyword Cloud for Lianatech.se

dittamp mediaharvivadprenumereradigdukontakta ossnbspprenumerera p nyhetsbrevboka demovarloumlsningarprenumerera pamp publicering offentligoffentlig sektor ampdemokanepostmarknadsfringdigitalaliana omautomationpublicering offentligmarknadsfoumlringoffentliglspr ampgfrwebbplatspr amp medianbsp nbsp nbsptjnsterom ossp nyhetsbrevbloggavlivetprtafunctiontechnologiesomoch mediebevakningflerideelltpartnerbranschereventsmanagermerbranscher bilindustrin utbildningssektornrestaurangutbildningssektornbilindustrin utbildningssektornpubliceringamp ideellt andrabilindustrinkontaktpvaringrossbilindustrin utbildningssektorn hotellmarketing automationmedandrafretagutbildningssektorn hotell ampdigitalnbsp nbspattmobillsningarfr attrestaurang mediag tillamplianamediaochkundkunderehandelliana technologiesutbildningssektorn hotellandra branscherhotell amp restaurangliana om osssomhotell ampledigaparingsektor amp ideelltlianacloudcookiesmedia amp publiceringplattformsektor ampoffentlig sektorbokatillrestaurang media ampkontaktanyhetsbrevpressmeddelandenbranscher bilindustrinamp ideelltmediebevakningmarketingmarknadsfringamp restaurangsektorfoumlrverktyg frderasideellt andraamp publiceringideellt andra branscheraumlrditt fretaglianacrewetthotellverktygkundreferenserblilianacrew livetmedia ampamp restaurang mediapublicering offentlig sektor

Longtail Keyword Density for Lianatech.se

KeywordsOccurences
nbsp nbsp nbsp24
publicering offentlig sektor3
prenumerera p nyhetsbrev3
liana om oss3
ideellt andra branscher3
amp ideellt andra3
sektor amp ideellt3
offentlig sektor amp3
pr amp media3
branscher bilindustrin utbildningssektorn3
media amp publicering3
restaurang media amp3
amp restaurang media3
hotell amp restaurang3
utbildningssektorn hotell amp3
bilindustrin utbildningssektorn hotell3
amp publicering offentlig3
nbsp nbsp25
marketing automation9
om oss6
prenumerera p5
g till4
pr amp4
fr att4
kontakta oss4
amp ideellt3
ditt fretag3
p nyhetsbrev3
boka demo3
lianacrew livet3
liana om3
andra branscher3
ideellt andra3
publicering offentlig3
sektor amp3
offentlig sektor3
verktyg fr3
amp publicering3
media amp3
restaurang media3
amp restaurang3
hotell amp3
utbildningssektorn hotell3
bilindustrin utbildningssektorn3
branscher bilindustrin3
och mediebevakning3
amp media3
liana technologies3
och36
nbsp29
fr17
att15
amp15
p14
liana13
marketing13
med10
som10
nyhetsbrev10
till10
oss10
om9
har9
automation9
media8
av8
pressmeddelanden7
mer7
digital7
prenumerera6
var6
pr6
branscher6
e-handel6
cookies6
mobil6
blogg5
vi5
fler5
kunder5
foumlr5
paring5
tjnster4
ls4
lsningar4
e-postmarknadsfring4
lianacloud4
ditt4
function4
bli4
plattform4
demo4
du4
kontakta4
g4
technologies3
varingr3
kund3
manager3
vad3
aumlr3
digitala3
marknadsfoumlring3
deras3
ta3
loumlsningar3
livet3
kan3
sektor3
verktyg3
webbplats3
mediebevakning3
bilindustrin3
utbildningssektorn3
hotell3
restaurang3
publicering3
offentlig3
ideellt3
marknadsfring3
andra3
kundreferenser3
events3
lianacrew3
lediga3
boka3
kontakt3
partner3
fretag3
ett3
dig3

Who hosts Lianatech.se?

Lianatech.se Hosting Provider Information

Hosted IP Address:Not Applicable
Hosted Hostname:Not Applicable
Service Provider:Unknown
Hosted Country:Not Applicable
Location Latitude:Not Applicable
Location Longitude:Not Applicable
Webserver Software:nginx

Is "Unknown" in the Top 10 Hosting Companies?

Name
Percentage
GOOGLE
16.3509%
Unknown
7.9282%
AS-26496-GO-DADDY-COM-LLC
4.2120%
NAMECHEAP-NET
3.4686%
AMAZON-AES
2.5797%
GoDaddy.com, LLC
2.3421%
UNIFIEDLAYER-AS-1
2.2322%
Fara Negar Pardaz Khuzestan
1.8901%
CONFLUENCE-NETWORK-INC
1.6374%
1&1 Internet AG
1.5839%

HTTP Header Analysis for Lianatech.se

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx
Date: Thu, 22 Jul 2021 17:30:56 GMT
Content-Type: text/html; charset=UTF-8
Content-Length: 23207
Connection: keep-alive
Vary: Accept-Encoding
ETag: W/"301bd1d983638188cddc87dcfe92d4b4"
Content-Encoding: gzip
X-Varnish: 42832493
Age: 0
Via: 1.1 varnish (Varnish/5.0)
Accept-Ranges: bytes

Lianatech.se Domain Nameserver Information

HostIP AddressCountry
ns1.viidakko.fi 188.117.16.116Finland Finland
ns2.viidakko.fi 37.35.80.80Finland Finland
ns3.viidakko.net 83.136.254.200United Kingdom United Kingdom
ns4.viidakko.net 94.237.64.225Finland Finland


Need to find out who hosts Lianatech.se?


Domain Registration (WhoIs) information for Lianatech.se

 # Copyright (c) 1997- The Swedish Internet Foundation.
# All rights reserved.
# The information obtained through searches, or otherwise, is protected
# by the Swedish Copyright Act (1960:729) and international conventions.
# It is also subject to database protection according to the Swedish
# Copyright Act.
# Any use of this material to target advertising or
# similar activities is forbidden and will be prosecuted.
# If any of the information below is transferred to a third
# party, it must be done in its entirety. This server must
# not be used as a backend for a search engine.
# Result of search for registered domain names under
# the .se top level domain.
# This whois printout is printed with UTF-8 encoding.
#
state: active
domain: lianatech.se
holder: eds1504-13760811
admin-c: eds0903-00002
tech-c: eds0903-00002
billing-c: eds0903-00001
created: 2015-04-08
modified: 2021-04-01
expires: 2022-04-08
nserver: ns1.viidakko.fi
nserver: ns2.viidakko.fi
nserver: ns3.viidakko.net
nserver: ns4.viidakko.net
dnssec: unsigned delegation
registry-lock: unlocked
status: ok
registrar: EuroDNS S.A

Websites with Similar Names

Liana-afuni.com
click.com.cn
Liana-cl.com
Liana Clinic
Liana-escort-vip.com
Kurtköy Escort | Maltepe Escort | Ataşehir Escort | Kadıköy Escort | Ümraniye Escort | Escort Bayan İlanları
Liana-george.com
Liana George – Actress
Liana-kunstfelsen.de
Willkommen bei LIANA Kunstpflanzen Ihr Partner im Bereich Kunstpflanzen
Liana-nail.com
リアーナネイルサロン福島区 - LianA Nail

Recently Updated Websites

15net.com (4 seconds ago.)Huznukomik.net (6 seconds ago.)Forisbc.com (7 seconds ago.)Empresalimpiezadenia.com (11 seconds ago.)Palmbeachinfluence.com (11 seconds ago.)Shibanotoramaru.online (16 seconds ago.)Lehrphotography.net (16 seconds ago.)Decoalsolutions.com (17 seconds ago.)Bahrainteslaexperience.com (19 seconds ago.)Diffen.com (19 seconds ago.)Fleximiz.com (21 seconds ago.)Variable-energy.com (22 seconds ago.)Cheerpoke.buzz (28 seconds ago.)Tlcbelieve.com (30 seconds ago.)Daigou11.com (30 seconds ago.)Healthstart.net (34 seconds ago.)Vvizn.com (35 seconds ago.)Pomadeguide.com (36 seconds ago.)Agralmarket.com (36 seconds ago.)Ensualhr.com (43 seconds ago.)Dostoevskiy-lit.ru (44 seconds ago.)Yemekyapin.com (45 seconds ago.)Impresionesmillenium.com (47 seconds ago.)Cluep.org (48 seconds ago.)Pmoa.co.jp (48 seconds ago.)Medicallyconnectedhome.com (52 seconds ago.)Candyclock.com (57 seconds ago.)Jf-kamigotou.or.jp (58 seconds ago.)Clientsciencecourse.com (58 seconds ago.)Lifemademanufacturing.com (1 minute 5 seconds ago.)

Recently Searched Keywords

yamalube (3 seconds ago.)nailit handyman (4 seconds ago.)smartphone reviews (5 seconds ago.)not miss (6 seconds ago.)东方神起 my girlfriend(less vocal)yuchun 在线下载试听 (10 seconds ago.)emlaktan beyolda (11 seconds ago.)mersin akdeniz camiierif (12 seconds ago.)myyogamate (12 seconds ago.)nakliyat stanbul nakliyat (14 seconds ago.)mersin akdeniz 225000 (15 seconds ago.)does not guarantee (16 seconds ago.)deneyiniz (16 seconds ago.)paylam mimari (16 seconds ago.)emlaktan beyolda satilik (19 seconds ago.)python books (20 seconds ago.)meet jeff (22 seconds ago.)fütürist ekonomist ufuk tarhan (22 seconds ago.)emlaktan barbarosta full (23 seconds ago.)t-nsan (23 seconds ago.)hunting air rifles (26 seconds ago.)mersin akdeniz 170000 (28 seconds ago.)beneteau (30 seconds ago.)devamı >>> (30 seconds ago.)previousrequire (31 seconds ago.)air venturi v10 target air pistolavailable in .17712 reviewsonly $269.99 (33 seconds ago.)officials-kmspico.com (33 seconds ago.)m-gen grup (33 seconds ago.)11 января 2015 — день ухода шрилы джаядевы госвами (35 seconds ago.)uk office page (35 seconds ago.)bargain bunker (36 seconds ago.)