Liber.se

Liber Läromedel & Kurslitteratur

Safety: Low trust score
Year Founded: 1994
Global Traffic Rank: 300,438
Estimated Worth: $30,780
Last updated:2020-11-03

Kunskap som gör skillnad. I samarbete med forskare och författare erbjuder vi läromedel, kurslitteratur och managementlitteratur av hög kvalitet.


Domain summary

Domain label
liber
Domain extension
se
Domain registered:
1994-04-15
Domain updated:
2020-11-03
Domain expires:
2020-12-31
Global Traffic Rank
300,438
Statvoo Rating
G
Trust Score
Low Trust Score
Estimated worth
$30,780
Estimated daily income
$57
Estimated monthly income
$1,734

Rank summary

How is liber.se ranked relative to other sites:

Percentage of visits to liber.se from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Liber.se registered?
A: Liber.se was registered 26 years, 7 months, 2 weeks, 5 days, 11 hours, 46 minutes, 16 seconds ago on Friday, April 15, 1994.
Q: When was the WHOIS for Liber.se last updated?
A: The WHOIS entry was last updated 1 month, 1 day, 11 hours, 46 minutes, 16 seconds ago on Tuesday, November 3, 2020.
Q: What are Liber.se's nameservers?
A: DNS for Liber.se is provided by the following nameservers:
  • ns4.web-solutions.eu
  • ns3.web-solutions.eu
  • ns2.web-solutions.dk
  • ns.web-solutions.dk
Q: Who is the registrar for the Liber.se domain?
A: The domain has been registered at NIC-SE.
Q: What is the traffic rank for Liber.se?
A: Liber.se ranks 300,438 globally on Alexa. Liber.se has a Low Trust Score, and a Statvoo Rank of G.
Q: How many people visit Liber.se each day?
A: Liber.se receives approximately 5,126 visitors and 20,504 page impressions per day.
Q: What IP address does Liber.se resolve to?
A: Liber.se resolves to the IPv4 address 104.40.244.70.
Q: In what country are Liber.se servers located in?
A: Liber.se has servers located in the Netherlands.
Q: What webserver software does Liber.se use?
A: Liber.se is powered by webserver.
Q: Who hosts Liber.se?
A: Liber.se is hosted by Microsoft Corporation in North Holland, Amsterdam, Netherlands, 1091.
Q: How much is Liber.se worth?
A: Liber.se has an estimated worth of $30,780. An average daily income of approximately $57, which is roughly $1,734 per month.

Liber.se Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Liber.se Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Liber.se

H1 Headings

1 :
  1. Upp till 20% rabatt!

H2 Headings

1 :
  1. Varukorg

H3 Headings

2 :
  1. Anette, Stenbackaskolan, om Matematik X Digital
  2. Stefan, NO-lärare

H4 Headings

5 :
  1. Grundskola
  2. Gymnasium/Vux
  3. Sva/Sfi
  4. Högskola
  5. Management

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

1 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

26:
  1. http://liber.se/
    http://liber.se/
  2. Liber Kontakt
    http://liber.se/kontakt
  3. Liber Till erbjudandet
    http://liber.se/erbjudande
  4. Liber nocoverCreated with Sketch.Förskolans teknikundervisning
    http://liber.se/produkt/forskolans-teknikundervisning-24998
  5. Liber nocoverCreated with Sketch.Livet i Mattelandet
    http://liber.se/serie/livet-i-mattelandet-26691
  6. Liber nocoverCreated with Sketch.Matematik Alfa Beta Gamma
    http://liber.se/serie/matematik-alfa-beta-gamma-16755
  7. Liber nocoverCreated with Sketch.Matematik XYZ
    http://liber.se/serie/matematik-xyz-25585
  8. Liber nocoverCreated with Sketch.SOS Samhälle 7-9
    http://liber.se/serie/sos-samhalle-79-28099
  9. Liber nocoverCreated with Sketch.Matematik Numerus
    http://liber.se/serie/matematik-numerus-26688
  10. Liber Grundskola
    http://liber.se/grundskola
  11. Liber Läromedel för gymnasium
    http://liber.se/gymnasium
  12. Liber Läromedel för vuxenutbildning
    http://liber.se/vuxenutbildning
  13. Liber Kurslitteratur
    http://liber.se/hogskola
  14. Liber Kompetensutveckling
    http://liber.se/kompetensutveckling
  15. Liber Kontakta Kundservice
    http://liber.se/kontakt
  16. Liber Bli avtalskund
    http://liber.se/avtalskund
  17. Liber Om Liber
    http://liber.se/om-liber
  18. Liber Event
    http://liber.se/event
  19. Liber Nyhetsbrev
    http://liber.se/nyhetsbrev
  20. Liber Lediga jobb
    http://liber.se/jobb
  21. Liber Press
    http://liber.se/press
  22. Liber Rättigheter
    http://liber.se/rattigheter
  23. Liber Köpvillkor
    http://liber.se/kopvillkor
  24. Liber Integritetspolicy
    http://liber.se/integritetspolicy
  25. Liber Liber Online
    http://liber.se/liberonline
  26. Liber För lärare i svenska
    http://liber.se/laromedel-svenska

Links - Internal (nofollow)

0:

Links - Outbound

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Liber.se

terkopplingdigitala produkteroch kemi kfr attfastarbetar medoch rduerbjuder bde trycktannnconst onclicksegmentproductmattelandetdet hrlnkarmaterialprodukt materialetstrukturdig som lrarekemi kihop klassenkvalitetfr dustuffsvenska somom teknikmjlighetupp svenska somheltckandefrstom soversionkunnahgskolanhar vi13kapitelformativlikvrdigvarjeavprogrammeringgenomgngartopmest populraliberkommundigital lrarlicensgr skillnadsamhllenualfa betavrtmed digitalttrycktalttarelromedletlttillgngligage allamatematikdu rtillgng tilltrycktonclicksegmentproduct u003e nrnsigutvrderingsexemplarimagetitlebestll utvrderingsexemplarfileurlimagesctfassetsnet1v9ieufzsrqh4c6jjtkjq6f1ht5yoq8dkh0604ddc79cdaf38d757db1e29e6309f3hogskolakarusellic2jpgdetailssize364863imagewidth2880height1440filenamehogskolakarusellic2jpgcontenttypeimagejpegbuttontitlebestll hrurluniutvmetatitleutgivningdrfrsomlivetalfatop editorial areaden produkt materialetundervisarnyttls merhamaterialetvrfrskolans3skolaimagetitleflickasvrareblendedsinatredigitalafrnk f3grundskolaparenturlsakf3grundskolaautocompletedontbcker och digitalaurval avutvrderingsexemplarimagetitlebestllden produktdifferencedestinationhrefcardimagesysspacesystypelinklinktypespaceid1v9ieufzsrqhid6c8l81mxrvnyrf1s6in5autypeassetcreatedat20200525t144355378zupdatedat20200525t144355378zenvironmentsysidmastertypelinklinktypeenvironmentrevision1localeenusfieldstitlecontent card imagesedanextramaterial hittar duelevernaerbjuderrural cangemensamma genomgngardetundervisningnivlrarmaterialtryckta och digitalavictainnehllerfr elevernafokus phistoriadigbckerkomplementkomplement from vra digitalavarxdr allau003ennu003ccenteru003ese allalnkar tilllromedel frmendigitala lromedelmergeografi 79deutschfinnsdu somhangeruppgifteronclicksegmentctahittavrafrutsttningar frhrurluniutvmetatitleutgivningutvrderingsexemplarfileurlimagesctfassetsnet1v9ieufzsrqh4c6jjtkjq6f1ht5yoq8dkh0604ddc79cdaf38d757db1e29e6309f3hogskolakarusellic2jpgdetailssize364863imagewidth2880height1440filenamehogskolakarusellic2jpgcontenttypeimagejpegbuttontitlebestll hrurluniutvmetatitleutgivningteknikmed sinafrhgskoladu ettfr en likvrdigsverigesverige drvningsmaterialp rttlsimage officedescriptioncontent cardkartlggning katt anvndabetareditorial areap attvr vrldlromedel fr kofficedescriptioncontent card imageu003cscript typetextjavascriptu003ennconst onclicksegmentctaenglishvrldsuppgifter ptryckt ochalla lyckas medoch digitaltfr hgskolaupp matematikfljafr dig somn windowanalyticstrackclicked ctasom lrarebedmningsstdproduktsidan fr dennnnconst onclicksegmentproduct u003ekartlggning79grundskolaparenturlsak79grundskolaautocompletedontsvenska som andrasprk1grundbok medgenom helaarbeta medtydligu003cscript typetextjavascriptu003ennconstkvalitetsskratk 79grundskolaparenturlsak79grundskolaautocompletedontls mer omuniversitetgold kmed sosquestcard image officebarakursdentill varjeatt ducannyimagelromedel fr rskurstypetextjavascriptu003ennconstoch arbetargeografikurslitteraturskt pupp svenskaelevlicens ochmakesosverktygurshar variturval av vrahar skt pyour englishvariationu003ennu003ccenteru003ese alla lromedelelevteachingtitletext5dinabrablidu kanonclicksegmentcta u003e n2behvernyavaritgenomdigitalt vningsmaterialatt arbetasinnumiconhur dur lrareutgrfr gymnasietfrgorcard image officedescriptioncontentkompetensutvecklinglsningarpopulra4 digital5anvnderannatu003evra mest populraihophelastuff gold kharfr hgskolanelevlicens och digital46attdigitala komplementgymnasiuminnehlletteachingtitletext5 ways teachersofficedig somextramaterial hittarfrskoleklass79samtidigtbakgrundarbetarge alla meningsfullahittargymnasietkommau003e n windowanalyticstrackclickedurvals attblandfrmgordu som lrarecta in subhubbstablirways teacherssubhub nnnconst onclicksegmentproductvaramestmer omgemensammalromedel kfysik ktamer om vrasom du hartvserieandrasprk kartlggningrttplus ktill 20fr rskursfysik och kemiprodukttypetextjavascriptu003ennconst onclicksegmentcta u003esom andrasprk kartlggningnu003cbrellerskautvrderingsexemplarfileurlimagesctfassetsnet1v9ieufzsrqh4c6jjtkjq6f1ht5yoq8dkh0604ddc79cdaf38d757db1e29e6309f3hogskolakarusellic2jpgdetailssize364863imagewidth2880height1440filenamehogskolakarusellic2jpgcontenttypeimagejpegbuttontitlebestllu003cbrtestatop editorialmaterialet hrn windowanalyticstrackclickedatt komma vidarefr den produktbcker ochsom arbetarnnnconstmed etttillmer om digitalayouralla meningsfullalikvrdig skolaimagetitleflicka medskillnadgrundbokenochvldu plrarlicensklassrummethittar dupplusflerau003cbr u003ennu003ccenteru003esevra digitalacard imageatt selyckasexempel pingrdigitalbdeimage officedescriptioncontentstdtryckt och digitaltutmaningsttockslromedelrural can makevarje kapitelom digitalahar sktsktfrmgornaf3grundskolaparenturlsakf3grundskolaautocompletedontkantryckta ochsom undervisarerbjuder bdeproductsmtrsiteidkurslitteratur frursom grskapaalla meningsfulla uppgifterstoru003e nhjlpvensjlvrttandeoch kemican makesoprodukter0u003cbr u003ennu003ccenteru003ese allastegk 46grundskolaparenturlsak46grundskolaautocompletedontbland annatelevlicensonclicksegmentproductoch digitallromedel medundervisningenkngrundbok med digitaltonclicksegmentproduct u003ecarddinanvndatryckta bckeronclicksegmentcta u003ebde tryckta bckerdu p produktsidanalltetttillgngutvecklasom fysik ochlrare och3 productsfr eleverolikaosswindowanalyticstrackclicked on onehjlp attoch digitalateachers in ruralwindowanalyticstrackclicked ctagrommatematikenlikvrdig skolaimagetitleflickamedcentralaav vraoch digitala komplementnivnamematematikandrasprk kartlggning klyckas med sinau003enn6vilkenmake a differencedestinationhrefcardimagesysspacesystypelinklinktypespaceid1v9ieufzsrqhid6c8l81mxrvnyrf1s6in5autypeassetcreatedat20200525t144355378zupdatedat20200525t144355378zenvironmentsysidmastertypelinklinktypeenvironmentrevision1localeenusfieldstitlecontentfinns ockseditorialhjlp att kommafr dengrundlggandemsofficedescriptioncontent cardruralsos samhlleofficedescriptioncontentmeningsfullasubhublromedel ochatt kommasubhub nnnconstvillhonom fysiklyckas meddittdr alla lyckasnumerusalla lromedelextramaterialkomma vidaregebiologiuppautofillmetatitlelromedelhistoria 79waysalla lromedel frmatematiskadifferencedestinationhrefcardimagesysspacesystypelinklinktypespaceid1v9ieufzsrqhid6c8l81mxrvnyrf1s6in5autypeassetcreatedat20200525t144355378zupdatedat20200525t144355378zenvironmentsysidmastertypelinklinktypeenvironmentrevision1localeenusfieldstitlecontentdu hittarproduktsidan frdigital elevlicens ochvra mestsverigesallaalla lyckasett urval avquest khurteachersutvrderingsexemplarimagetitlebestll utvrderingsexemplarfileurlimagesctfassetsnet1v9ieufzsrqh4c6jjtkjq6f1ht5yoq8dkh0604ddc79cdaf38d757db1e29e6309f3hogskolakarusellic2jpgdetailssize364863imagewidth2880height1440filenamehogskolakarusellic2jpgcontenttypeimagejpegbuttontitlebestllinnehllgymnasietsarbetau003ennu003ccenteru003esedrinom46grundskolaparenturlsak46grundskolaautocompletedontheltengelskaeleverkunskapdifferencedestinationhrefcardimagesysspacesystypelinklinktypespaceid1v9ieufzsrqhid6c8l81mxrvnyrf1s6in5autypeassetcreatedat20200525t144355378zupdatedat20200525t144355378zenvironmentsysidmastertypelinklinktypeenvironmentrevision1localeenusfieldstitlecontent cardandrasprkom vraniveru003cbr u003ennlrareprodukt materialet hrdigitaltfnotryckta bcker ochefterp produktsidan frnnudigital elevlicensett urvalgrundbokdirektu003cscriptpedagogiskahosgoldbde trycktafysik ochsom villareamed fokus pkemiteknikundervisningfr gymnasietsbttreu0026vningarbiologi kvidtill exempelmeningsfulla uppgiftermodernateachingtitletext5 waysmjlighet attsom andrasprk4av vra mestmngainteproduktsidankunskap somsep produktsidankommersketchmatematikhittar du pfr kfrutsttningarfr digav bdekomvuxstuff goldutvecklasom durskurstypetextjavascriptu003ennconst onclicksegmentctasverige dr allamed fokusvidarestudierfokusdu hardig som undervisarserienandradu frwindowanalyticstrackclickedklassenhroneexempelskolaimagetitleflicka medfysiksittimage officesvenskamatematik och

Longtail Keyword Density for Liber.se

KeywordsOccurences
lyckas med sina8
fr dig som8
sverige dr alla7
dr alla lyckas7
alla lyckas med7
officedescriptioncontent card image6
image officedescriptioncontent card6
card image officedescriptioncontent6
rural can make6
teachers in rural6
u003e n windowanalyticstrackclicked6
teachingtitletext5 ways teachers6
stuff gold k6
har skt p5
bde tryckta bcker5
alla lromedel fr5
card image office4
med fokus p4
du som lrare4
u003ennu003ccenteru003ese alla lromedel4
u003cbr u003ennu003ccenteru003ese alla4
elevlicens och digital4
tryckt och digitalt4
ls mer om4
p produktsidan fr4
produktsidan fr den4
fr den produkt4
grundbok med digitalt4
som du har3
mer om digitala3
digital elevlicens och3
utvrderingsexemplarimagetitlebestll utvrderingsexemplarfileurlimagesctfassetsnet1v9ieufzsrqh4c6jjtkjq6f1ht5yoq8dkh0604ddc79cdaf38d757db1e29e6309f3hogskolakarusellic2jpgdetailssize364863imagewidth2880height1440filenamehogskolakarusellic2jpgcontenttypeimagejpegbuttontitlebestll hrurluniutvmetatitleutgivning3
att komma vidare3
dig som lrare3
tryckta och digitala3
differencedestinationhrefcardimagesysspacesystypelinklinktypespaceid1v9ieufzsrqhid6c8l81mxrvnyrf1s6in5autypeassetcreatedat2020-05-25t144355378zupdatedat2020-05-25t144355378zenvironmentsysidmastertypelinklinktypeenvironmentrevision1localeen-usfieldstitlecontent card image3
alla meningsfulla uppgifter3
ge alla meningsfulla3
make a differencedestinationhrefcardimagesysspacesystypelinklinktypespaceid1v9ieufzsrqhid6c8l81mxrvnyrf1s6in5autypeassetcreatedat2020-05-25t144355378zupdatedat2020-05-25t144355378zenvironmentsysidmastertypelinklinktypeenvironmentrevision1localeen-usfieldstitlecontent3
produkt materialet hr3
den produkt materialet3
du p produktsidan3
hittar du p3
extramaterial hittar du3
hjlp att komma3
lromedel fr rskurs3
vra mest populra3
likvrdig skolaimagetitleflicka med3
upp svenska som3
svenska som andrasprk3
som andrasprk kartlggning3
andrasprk kartlggning k3
dig som undervisar3
erbjuder bde tryckta3
tryckta bcker och3
bcker och digitala3
och digitala komplement3
ett urval av3
urval av vra3
av vra mest3
mer om vra3
och kemi k3
om vra digitala3
lromedel fr k3
u003cscript typetextjavascriptu003ennconst onclicksegmentcta3
typetextjavascriptu003ennconst onclicksegmentcta u003e3
onclicksegmentcta u003e n3
n windowanalyticstrackclicked cta3
cta in subhub3
subhub nnnconst onclicksegmentproduct3
nnnconst onclicksegmentproduct u003e3
fr en likvrdig3
windowanalyticstrackclicked on one3
top editorial area3
om fysik och3
fysik och kemi3
onclicksegmentproduct u003e n3
card image20
lromedel fr18
fr dig15
fr att15
k 7-9grundskolaparenturlsak-7-9grundskolaautocompletedont14
med digitalt14
kartlggning k12
hittar du11
dig som11
lyckas med9
och digitala9
k 4-6grundskolaparenturlsak-4-6grundskolaautocompletedont9
som lrare9
dr alla8
digitala lromedel8
med sina8
stuff gold8
digitalt vningsmaterial8
utvrderingsexemplarimagetitlebestll utvrderingsexemplarfileurlimagesctfassetsnet1v9ieufzsrqh4c6jjtkjq6f1ht5yoq8dkh0604ddc79cdaf38d757db1e29e6309f3hogskolakarusellic2jpgdetailssize364863imagewidth2880height1440filenamehogskolakarusellic2jpgcontenttypeimagejpegbuttontitlebestll8
k f-3grundskolaparenturlsak-f-3grundskolaautocompletedont8
tryckta bcker7
svenska som7
mer om7
alla lyckas7
sverige dr7
och r7
har skt7
teachingtitletext5 ways6
ways teachers6
n windowanalyticstrackclicked6
rural can6
u003e n6
grundbok med6
image officedescriptioncontent6
officedescriptioncontent card6
att du6
och digitalt6
can make6
matematik och6
fokus p6
gold k6
bde tryckta6
om teknik6
lromedel k6
quest k6
fr hgskola5
lrare och5
frutsttningar fr5
du kan5
fr du5
upp svenska5
plus k5
fysik och5
fr k5
skt p5
av vra5
alfa beta5
ls mer5
elevlicens och5
u003cbr u003ennu003ccenteru003ese5
du ett5
alla lromedel5
att komma4
arbetar med4
som vill4
som du4
p produktsidan4
tryckt och4
produktsidan fr4
fr rskurs4
fr den4
om vra4
image office4
mjlighet att4
och digital4
bcker och4
du som4
som gr4
vra digitala4
u003ennu003ccenteru003ese alla4
den produkt4
fr eleverna4
varje kapitel4
med fokus4
arbeta med4
uppgifter p4
och kemi4
kemi k4
du r3
r lrare3
du hittar3
du har3
till varje3
till 203
har vi3
alla meningsfulla3
finns ocks3
till exempel3
sos samhlle3
med sos3
bland annat3
har varit3
digital elevlicens3
komma vidare3
det hr3
p rtt3
meningsfulla uppgifter3
ge alla3
lnkar till3
ihop klassen3
gemensamma genomgngar3
s att3
fr elever3
exempel p3
p att3
differencedestinationhrefcardimagesysspacesystypelinklinktypespaceid1v9ieufzsrqhid6c8l81mxrvnyrf1s6in5autypeassetcreatedat2020-05-25t144355378zupdatedat2020-05-25t144355378zenvironmentsysidmastertypelinklinktypeenvironmentrevision1localeen-usfieldstitlecontent card3
materialet hr3
produkt materialet3
du p3
extramaterial hittar3
och arbetar3
biologi k3
tillgng till3
urval av3
3 products3
onclicksegmentproduct u003e3
nnnconst onclicksegmentproduct3
subhub nnnconst3
windowanalyticstrackclicked cta3
onclicksegmentcta u003e3
typetextjavascriptu003ennconst onclicksegmentcta3
u003cscript typetextjavascriptu003ennconst3
u003cbr u003enn3
mest populra3
vra mest3
ett urval3
editorial area3
digitala komplement3
erbjuder bde3
som undervisar3
andrasprk kartlggning3
som andrasprk3
om so3
vr vrld3
skolaimagetitleflicka med3
likvrdig skolaimagetitleflicka3
hjlp att3
att se3
top editorial3
om fysik3
tryckta och3
lromedel med3
att anvnda3
med ett3
du fr3
kurslitteratur fr3
fr hgskolan3
utvrderingsexemplarfileurlimagesctfassetsnet1v9ieufzsrqh4c6jjtkjq6f1ht5yoq8dkh0604ddc79cdaf38d757db1e29e6309f3hogskolakarusellic2jpgdetailssize364863imagewidth2880height1440filenamehogskolakarusellic2jpgcontenttypeimagejpegbuttontitlebestll hrurluniutvmetatitleutgivning3
digitala produkter3
fr gymnasiet3
fr gymnasiets3
hur du3
att arbeta3
genom hela3
4 digital3
gr skillnad3
kunskap som3
your english3
historia 793
geografi 7-93
fysik k3
om digitala3
som arbetar3
komplement fr3
lromedel och3
av bde3
upp matematik3
digital lrarlicens3
och218
fr144
k116
med114
som80
att67
p66
r57
du56
lromedel49
har42
till38
digitalt37
av34
om34
alla32
digitala31
digital26
ett25
svenska24
kan23
det22
card21
image20
matematik20
dig20
upp20
lrare19
dr19
eller19
den16
vi16
samhlle15
eleverna15
inom14
hittar14
kartlggning14
7-9grundskolaparenturlsak-7-9grundskolaautocompletedont14
vra14
mer14
rn-14
n14
lyckas14
tryckta13
varje13
bde12
s12
teknik11
finns11
elever11
fysik11
hela11
arbetar11
sina11
niv10
erbjuder10
7-910
vill9
bcker9
4-6grundskolaparenturlsak-4-6grundskolaautocompletedont9
u003cbr9
uppgifter9
gr9
mnga9
vningsmaterial9
hr9
kapitel8
f-3grundskolaparenturlsak-f-3grundskolaautocompletedont8
utvrderingsexemplarimagetitlebestll8
utvrderingsexemplarfileurlimagesctfassetsnet1v9ieufzsrqh4c6jjtkjq6f1ht5yoq8dkh0604ddc79cdaf38d757db1e29e6309f3hogskolakarusellic2jpgdetailssize364863imagewidth2880height1440filenamehogskolakarusellic2jpgcontenttypeimagejpegbuttontitlebestll8
stt8
sos8
olika8
alfa8
tryckt8
sin8
stuff8
gold8
arbeta7
allt7
skt7
hgskola7
frn7
no7
deutsch7
kemi7
ls7
biologi7
fokus7
tre7
innehllet7
grundlggande7
hon7
sverige7
men6
ska6
exempel6
ways6
4-66
teachingtitletext56
grundbok6
rskurs6
klassen6
windowanalyticstrackclicked6
can6
beta6
din6
lttare6
hjlp6
elevlicens6
make6
helt6
ocks6
officedescriptioncontent6
teachers6
so6
quest6
u00266
undervisar6
rural6
u003ennu003ccenteru003ese6
u003e6
lromedlet5
genom5
gymnasium5
kunskap5
nu5
gymnasiet5
annat5
f5
extramaterial5
var5
mest5
flera5
bra5
blir5
se5
produkter5
behver5
frutsttningar5
grundboken5
ger5
vr5
bara5
std5
varit5
samtidigt5
komplement5
populra5
historia5
undervisningen5
stor5
blended5
vid5
mattelandet5
plus5
vningar5
05
genomgngar5
15
kunna5
sig4
office4
hos4
inte4
ihop4
drfr4
kommun4
numerus4
lrarlicens4
innehller4
centrala4
vidare4
struktur4
tydlig4
ge4
sedan4
serien4
lrarmaterial4
testa4
sitt4
gemensamma4
anvnder4
verktyg4
urs4
vara4
teknikundervisning4
produkt4
produktsidan4
mjlighet4
ta4
nivnamematematik4
geografi4
livet4
frgor4
kurslitteratur4
engelska4
ny4
x4
u003enn4
ditt4
liber4
hur4
kvalitet4
nya4
autofillmetatitlelromedel4
oss4
komma4
u003cscript3
urval3
frskoleklass3
1-33
meningsfulla3
matematiken3
numicon3
typetextjavascriptu003ennconst3
onclicksegmentcta3
cta3
subhub3
nnnconst3
onclicksegmentproduct3
variation3
one3
terkoppling3
products3
top3
rtt3
fast3
andrasprk3
utmaning3
23
efter3
lttillgngliga3
bttre3
sketchmatematik3
andra3
frmgorna3
bland3
han3
sjlvrttande3
svrare3
utvecklas3
nnu3
programmering3
33
ur3
frmgor3
vilken3
elev3
likvrdig3
skolaimagetitleflicka3
matematiska3
vrld3
flja3
editorial3
kompetensutveckling3
area3
kurs3
dina3
komvux3
hrurluniutvmetatitleutgivning3
hgskolan3
frst3
universitet3
43
ingr3
bakgrund3
skapa3
material3
tillgng3
bedmningsstd3
nytt3
bli3
steg3
undervisning3
klassrummet3
direkt3
anvnda3
ha3
sveriges3
nu003cbr3
utveckla3
bsta3
lsningar3
formativ3
frskolans3
vl3
vrt3
tv-serie3
ms3
53
63
ven3
your3
english3
niver3
pedagogiska3
studier3
mtrsiteid3
differencedestinationhrefcardimagesysspacesystypelinklinktypespaceid1v9ieufzsrqhid6c8l81mxrvnyrf1s6in5autypeassetcreatedat2020-05-25t144355378zupdatedat2020-05-25t144355378zenvironmentsysidmastertypelinklinktypeenvironmentrevision1localeen-usfieldstitlecontent3
skillnad3
materialet3
moderna3
kommer3
version3
lnkar3
gymnasiets3
kvalitetsskrat3
hitta3
heltckande3
innehll3
utgr3

Who hosts Liber.se?

Liber.se Hosting Provider Information

Hosted IP Address:104.40.244.70
Hosted Hostname:104.40.244.70
Service Provider:Microsoft Corporation
Hosted Country:NetherlandsNL
Location Latitude:52.3534
Location Longitude:4.9087
Webserver Software:Not Applicable

Is "Microsoft Corporation" in the Top 10 Hosting Companies?

Name
Percentage
GoDaddy.com, LLC
9.5100%
DoD Network Information Center
8.4509%
Google Inc.
2.8338%
Confluence Networks Inc
2.6217%
Amazon.com, Inc.
2.1737%
Namecheap, Inc.
2.1384%
TOT Public Company Limited
1.5665%
1&1 Internet AG
1.5512%
Merit Network Inc.
1.3856%
Unified Layer
1.3043%
Microsoft Corporation
0.3163%

HTTP Header Analysis for Liber.se

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Transfer-Encoding: chunked
Content-Type: text/html; charset=utf-8
Content-Encoding: gzip
ETag: "258e6-K2chJzqrkXOoHieKlljI0jaRT k"
Vary: Accept-Encoding
X-Powered-By: Next.js
X-Frame-Options: DENY
Date: Tue, 03 Nov 2020 10:38:14 GMT

Liber.se Domain Nameserver Information

HostIP AddressCountry
ns4.web-solutions.eu 208.111.42.190Hong Kong SAR China Hong Kong SAR China
ns3.web-solutions.eu 208.111.35.186United States United States
ns2.web-solutions.dk 185.12.179.209France France
ns.web-solutions.dk 81.7.150.66Denmark Denmark


Need to find out who hosts Liber.se?


Domain Registration (WhoIs) information for Liber.se

 # Copyright (c) 1997- The Swedish Internet Foundation.
# All rights reserved.
# The information obtained through searches, or otherwise, is protected
# by the Swedish Copyright Act (1960:729) and international conventions.
# It is also subject to database protection according to the Swedish
# Copyright Act.
# Any use of this material to target advertising or
# similar activities is forbidden and will be prosecuted.
# If any of the information below is transferred to a third
# party, it must be done in its entirety. This server must
# not be used as a backend for a search engine.
# Result of search for registered domain names under
# the .se top level domain.
# This whois printout is printed with UTF-8 encoding.
#
state: active
domain: liber.se
holder: (not shown)
admin-c: EEHHOL1211-10190
tech-c: EEHHOL1211-15171
billing-c: -
created: 1994-04-15
modified: 2019-12-22
expires: 2020-12-31
transferred: 2009-05-27
nserver: ns.web-solutions.dk
nserver: ns2.web-solutions.dk
nserver: ns3.web-solutions.eu
nserver: ns4.web-solutions.eu
dnssec: unsigned delegation
registry-lock: unlocked
status: ok
registrar: Web Solutions

Websites with Similar Names

Liber-al.com
Liber-AL.com
Liber-azione.org
Associazione Liber-Azione |
Liber-hair.com
Liber hair
Liber-hw.com
東京を中心にロープ工事を行う株式会社リーベルハイワークス
Liber-love.com
Tomo's Blog
Liber-tees.com
403 Forbidden
Liber-vin.dk
Liber vin - Spændende vinsmagning i Jylland og Fyn

Recently Updated Websites

Iconhostels.com (4 seconds ago.)L8vip4.com (14 seconds ago.)Juliathegeek.com (17 seconds ago.)Ldapp768.com (18 seconds ago.)Lapatrieliberee.com (19 seconds ago.)Intalphacop.live (19 seconds ago.)Santekhnika.com (23 seconds ago.)Jgj60555.com (24 seconds ago.)Johnbrouckaert.com (25 seconds ago.)Lagenced.com (26 seconds ago.)Jschulzdesign.com (26 seconds ago.)Kripakar.com (28 seconds ago.)Jasmingirltalk.com (29 seconds ago.)Jengkolbusuk.com (30 seconds ago.)Paintdragonstudio.net (32 seconds ago.)Shanemcclanahan.com (39 seconds ago.)Josephbellchoons.com (40 seconds ago.)Larrysusedcarsandtrucks.com (41 seconds ago.)Lasonorapodcasting.com (42 seconds ago.)Jrstricklandconstruction.com (43 seconds ago.)In-in-tour-packages-usas-ok.live (44 seconds ago.)Lakeview-venue.com (44 seconds ago.)Khattab81.com (45 seconds ago.)Jaybyunstudio.com (46 seconds ago.)Komolchandraghose.com (49 seconds ago.)Aronmatthie.com (49 seconds ago.)Jonnybucknall.com (51 seconds ago.)Kumisugai.com (52 seconds ago.)Lavantalar.com (53 seconds ago.)Jdtnt.com (54 seconds ago.)

Recently Searched Keywords

70d (5 seconds ago.)list_97 (7 seconds ago.)date var now (11 seconds ago.)soulshinesara (11 seconds ago.)програма (12 seconds ago.)dragon ball super (14 seconds ago.)para ti (18 seconds ago.)you during (18 seconds ago.)accolades (19 seconds ago.)gratitude (20 seconds ago.)sectionid pagebody (20 seconds ago.)c mak (20 seconds ago.)营业执照 (23 seconds ago.)mp3brand (23 seconds ago.)angeles electricians (23 seconds ago.)brookfield (24 seconds ago.)fc2ppv-1269674★初撮り顔出し☆gカップ巨乳のセクシーgalなぎさちゃ第02集 (25 seconds ago.)kitchens namibia (26 seconds ago.)about ladimax sports and fitness and nicole sanders (30 seconds ago.)oferty (32 seconds ago.)ku5325 (32 seconds ago.)list_47 (33 seconds ago.)led high bay verlichting | led klokarmaturen (35 seconds ago.)0 3 (38 seconds ago.)кошик (39 seconds ago.)-webkit-appearancenone-moz-appearancenoneborder-width0 background-colortransparentbox-sizingborder-box importantcolored5829border-stylesolidborder-colorrgba37 (42 seconds ago.)fa-fusion-boxbefore (42 seconds ago.)more_34 (44 seconds ago.)house surge (45 seconds ago.)know the several types of insurance (45 seconds ago.)