|  LIC - Life Insurance Corporation of India
Low trust score  | Website Information

Website Ranks & Scores for

Statvoo Rank Statvoo Rank:E
Alexa Rank Alexa Rank:4,603
Majestic Rank Majestic Rank:98,206
Domain Authority Domain Authority:59%
DMOZ DMOZ Listing:No

Whois information for

Full Whois Lookup for Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

Access to .IN WHOIS information is provided to assist persons in determining the contents of a domain name registration record in the .IN registry database. The data in this record is provided by .IN Registry for informational purposes only, and .IN does not guarantee its accuracy. This service is intended only for query-based access. You agree that you will use this data only for lawful purposes and that, under no circumstances will you use this data to: (a) allow, enable, or otherwise support the transmission by e-mail, telephone, or facsimile of mass unsolicited, commercial advertising or solicitations to entities other than the data recipient's own existing customers; or (b) enable high volume, automated, electronic processes that send queries or data to the systems of Registry Operator, a Registrar, or Afilias except as reasonably necessary to register domain names or modify existing registrations. All rights reserved. .IN reserves the right to modify these terms at any time. By submitting this query, you agree to abide by this policy.

Domain ID:D515963-AFIN
Created On:16-Feb-2005 06:59:21 UTC
Last Updated On:29-Jul-2015 11:06:12 UTC
Expiration Date:16-Feb-2025 06:59:21 UTC
Sponsoring Registrar:Net4India (R7-AFIN)
Registrant ID:N8R338861
Registrant Name:Executive Director IT BPR
Registrant Organization:Life Insurance Corporation of India
Registrant Street1:Central Office IT BPR Department 2nd Floor Jeevan Seva Annexe Sa
Registrant Street2:
Registrant Street3:
Registrant City:Mumbai
Registrant State/Province:MH
Registrant Postal Code:400054
Registrant Country:IN
Registrant Phone:+91.2222828665
Registrant Phone Ext.:
Registrant FAX:+91.2222851915
Registrant FAX Ext.:
Registrant Login to show email
Admin Name:Srinivasan Subramanian
Admin Organization:Life Insurance Corporation of India
Admin Street1:Central Office IT BPR Department 2nd Floor Jeevan Seva Annexe Sa
Admin Street2:
Admin Street3:
Admin City:Mumbai
Admin State/Province:MH
Admin Postal Code:400054
Admin Country:IN
Admin Phone:+91.2267090565
Admin Phone Ext.:
Admin FAX:+91.2267090581
Admin FAX Ext.:
Admin Login to show email
Tech Name:Pramod Kumar
Tech Organization:Life Insurance Corporation of India
Tech Street1:Central Office IT BPR Department 2nd Floor Jeevan Seva Annexe
Tech Street2:
Tech Street3:
Tech City:Mumbai
Tech State/Province:MH
Tech Postal Code:400054
Tech Country:IN
Tech Phone:+91.2267090510
Tech Phone Ext.:
Tech FAX:+91.2267090582
Tech FAX Ext.:
Tech Login to show email
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:

Who hosts is hosted by TATA Communications formerly VSNL is Leading ISP in India. has an IP Address of and a hostname of Web Server Information

Hosted IP Address:
Service Provider:TATA Communications formerly VSNL is Leading ISP
Hosted Country:IndiaIN
Location Latitude:20
Location Longitude:77
Webserver Software:Not Applicable

HTTP Header Analysis for

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Wed, 10 Jun 2015 02:32:30 GMT
Server: JeevanServer
Last-Modified: Tue, 09 Jun 2015 07:32:36 GMT
ETag: "23c8bd-a09b-51810c323cd00"
Accept-Ranges: bytes
ntCoent-Length: 41115
Connection: close
Content-Type: text/html; charset=UTF-8
Cache-Control: private
Content-Encoding: gzip
Content-Length: 10814

Need to find out who hosts Free SEO Report

Website Inpage Analysis for

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for

downloadjeevannopolicyneftpaymentlicplansagentclickpubliclife insurancecustomerdetailsportal0spuriouscorporatenavyourinsurancepremiumliferegardingbimapolicyholdersknowplannbspnbspnbspnbsponline

Longtail Keyword Density for

life insurance3

What are the nameservers for Domain Nameserver Information

HostIP AddressCountry India India Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if is a scam?