Digital Experience Software Tailored to Your Needs | Liferay

Safety: Low trust score
Year Founded: 2000
Global Traffic Rank: Unknown
Estimated Worth: $9
Category: This site has not been categorized yet

Build portals, intranets, websites and connected experiences on the most extensible digital experience platform around. Learn more.



Domain summary

Last updated
2021-06-02
Domain label
liferay
Domain extension
net
Domain registered:
2000-03-18
Domain updated:
2021-03-18
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Frequently Asked Questions (FAQ)

Q: When was Liferay.net registered?
A: Liferay.net was registered 21 years, 4 months, 1 week, 5 days, 8 hours, 27 minutes, 24 seconds ago on Saturday, March 18, 2000.
Q: When was the WHOIS for Liferay.net last updated?
A: The WHOIS entry was last updated 4 months, 1 week, 5 days, 8 hours, 27 minutes, 24 seconds ago on Thursday, March 18, 2021.
Q: What are Liferay.net's nameservers?
A: DNS for Liferay.net is provided by the following nameservers:
  • jim.ns.cloudflare.com
  • sofia.ns.cloudflare.com
Q: Who is the registrar for the Liferay.net domain?
A: The domain has been registered at GODADDY.COM, LLC.
Q: What is the traffic rank for Liferay.net?
A: Liferay.net has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Liferay.net each day?
A: Liferay.net receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Liferay.net resolve to?
A: Liferay.net resolves to the IPv4 address 173.196.212.15.
Q: In what country are Liferay.net servers located in?
A: Liferay.net has servers located in the United States.
Q: What webserver software does Liferay.net use?
A: Liferay.net is powered by CloudFlare webserver.
Q: Who hosts Liferay.net?
A: Liferay.net is hosted by TWC-20001-PACWEST in California, Los Angeles, United States, 90043.
Q: How much is Liferay.net worth?
A: Liferay.net has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Liferay.net Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Liferay.net Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Liferay.net

H1 Headings

1 :
  1. One Platform. Endless Solutions.

H2 Headings

3 :
  1. Empower Your Users While Reducing Cost-to-Serve
  2. Unify Disparate Systems for Employees, Agents, and Partners
  3. A History of Excellence

H3 Headings

0 :

H4 Headings

6 :
  1. "We have successfully implemented an e-commerce experience into the B2B space in which we operate. The quality of service has improved as clients prefer the simple and familiar nature of self-service ordering.”
  2. "Nobody's been able to throw anything at us that we couldn't handle. Our portal supports growing, changing business needs, but it does it in a way that we don't need to re-engineer it every time. It's pretty awesome."
  3. "We are transforming the way digital business is performed by changing the way the data is brought together and personalized for the individual. Liferay is at the leading edge of enabling that."
  4. Platform
  5. Company
  6. Expand & Connect

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

26 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

19:

Links - Internal (nofollow)

0:

Links - Outbound

76:

Links - Outbound (nofollow)

0:

Keyword Cloud for Liferay.net

ctalink svg webkittransformficonicontypesmall fragmentseditoreditabletypehtml ficonicontypesmallcostsfosbspacer height 0boxshadow 0 0900px fsingleimageexpandendcolor rgba255900px fsingleimageexpandstartfsingleimagedecorate fsingleimagewrapperficon fragmentseditoreditabletypehtmlquotecontainerbefore backgroundcolor55aceeftextsmallcapsdefault h2ftextheadingmarginrightautofgartnersingleintensity6li paddingbottom 075remdarkftextsmallcapsflogoswrapper colsm8 flogoswrapperlightficonicontypeaccentafter backgroundcolor 0b63cecontent display blockflogos flogostitlemarginright 1rem media5s cubicbezier191221ol li255 255block left 15remcomparisontablesubscriptioncol2content darkmodeficonicontypeaccentafter lighttrainingvideocollection columnfeaturedlight fsingleimagedecoratedark lightfsingleimagedecorate fsingleimagewrapperbeforedarkficonicontypeaccentafterrgba767676160 5em4rem 155px mediadark lightlightfsingleimagedescription color 545d69enlargebutton0b63ce borderradius 8px5em aui subscriptioncarddark ftextcontent900pxwidth 1em darkcontent listitemwrapperoltypedisplay none fgartner92px zindexdisplay inlineblockli paddingbottomaccordioncontentcolsm10 fgartnersystemsfhomebanner homebannerdescription maxwidthmsflexdirection rowcomparisontablecomponent comparisontabledatacol1rem mediaiconimg img05 light ftextcontentcloud featuresfsingleimagewrapperafter darkfsingleimagedecorate fsingleimagewrapperafterreverse msflexdirection columnreverseflex webkitboxflex 1auivarboxsizing borderboxfsingleimagedescription coloroverflow visiblecolsm3zindex 1bleedingimgwrapperborderbottomliststylevar i 0minwidth100 padding 05rem35sfragmentelementqueryselector aspectratioobjectfitcover var4s easeinout transitionmaxwidth 05rem topbody content listitemwrapperoltypeol libefore light1125em 5emrgba1091171288 boxshadowmedia minwidth 600px4s easeinout25s easeinoutwebkittransform 25scol12 fgartnerfsingleimageexpandstartlightftextcontent ol libeforefragmentseditoreditabletypeimage img ficoncounterincrement itemposition relativecolmd3 flogoswrapperfsingleimagewrapperbefore light darkborderboxmarginleft 35rem mediawegatedlandingpage quotecontainerdark fsingleimagedecorate fsingleimagewrapperbeforeflogoscontainershowbackgroundcolor backgroundcolor5emfgartnersingleintensity6 displayborderbottom 1px solidbleedingmediaimg displayeaseinout transition transformbackgroundcolor 0d5ab8 borderradiusleft 25empaddingleft 075rem ftextcontent1200px fsingleimageexpandendfgartnerlogo backgroundcolorcontentblockwebkitboxshadow 0 0flex 1 1relative media maxwidthfgartner fgartnersingleintensity6ficonicontypeaccentafter darkficonicontypeaccentafter lightlight fsingleimagedescription lightfsingleimagedescriptionheight 100 ficonicontypelargefsingleimagewrapperbefore lightfsingleimagedecorate fsingleimagewrapperbefore35rem fsingleimagedecorate fsingleimagewrapperrgba109117128160solid599px fsingleimageexpandstartficonicontypeaccentafter lightficonicontypeaccentafter darkcolmd2 fgartner colmd1flogoslogocolmd10599px fsingleimageexpandendfsingleimagedecorate marginleftnone ficonicontypeaccentaftermedia maxwidthftextheadingtextcentertabletportraitup marginleftabsolute top 0textdecoration underline ftextsmallcapscolmd11 fgartnerflogoswrapper colmd8colmd9 fgartner colmd8dark ftextsmallcapscolsm1 flogoswrapper colmd9rgba255 255 255fgartner colmd8 fgartner0b63ce contentfgartner fgartnerdescriptionmaxwidth 599px fsingleimageexpandendfsingleimagedecorate11pxwebkittransform none155px mediaftextcontentlightfsingleimagedescriptionchallenges5smaxwidth 5s cubicbezier191221widthimgstyleopacity8px content displaywidth 05em darkffffff lightcontact usmarginleft 0 marginrightflogoswrapper colmd1 flogoswrapperdark lightfsingleimagedecoratemargin1 auiborder 0backgroundsizebetter solutionsfsingleimagewrapper position relativeflogoswrapper col8 flogoswrapper255 06fgartner colsm2 fgartnermargin 0colmd7 fgartnerfsingleimageexpandstartfsingleimagedecorate fsingleimagewrapper marginleft6content gatedlandingpage formwrapperblock margintop10fsingleimagewrapperbleedingmediableedingmediaenlargeimg075rem ftextcontentlistspacingnonefgartner colmd2ftextsmallcaps darkftextsmallcapsfffffff4f6f9 borderradius5smaxwidth 5sinline fosbspacer heighticonimgmarginleft calccustomerminwidth 1200px fsingleimageexpandstartfsingleimagedecorate0b5fffcolsm9 fgartnertextalign leftgatedlandingpagedarkmode quotecontainerfontweight 600 dark05rem dark fsingleimagedecorateeaseinoutwebkittransformcontentwrapper contentblock webkitboxflexnone ftextsmallcapsspan displaycomparisontablegrouplabel display blockfsingleimageexpandstart fsingleimagewrapperimagesection playbuttoncol7none fosbspacersvg heightflogoswrapper colmd9 flogoswrappercardhovercolmd8 flogoswrapper0675em1em 1emdark lightfsingleimagedecorate fsingleimagewrapperaftermargintop 1rem paddingleftdisplay inline fosbspacercolsm2 flogoswrapperfsingleimageexpandstartfsingleimagedecorate fsingleimagewrapperfsingleimagedescription color 545d69colsm9 flogoswrapper colsm835remtransition webkittransformlibefore lightlightftextsmallcapswidth calc100lightftextsmallcaps dark lightftextsmallcapsfgartner colmd9ficonicontypeaccentafter darktranslatey0 transform translatey0fsingleimagedecorate fsingleimagewrapperbefore darkfsingleimagedecoratetextdecoration underlinecolmd9 flogoswrapperficon iconimgol libefore ftextcontent2s easeinout transitionfgartnerdescription margintopflogoswrapper colsm1fsingleimageexpandstartfsingleimagedecorate marginleft100 bleedingmedia599px fsingleimageexpandendfsingleimagedecorateh2 ftextsmallcapsdefault fontsizeaui subscriptioncard subscriptionitemwrapperrgba109117128160 5em1em sidebarmoleculepadding 2rem 1remlight dark ftextsmallcapslightfsingleimagedecorate fsingleimagewrapperafter backgroundcolorwebkitboxpack center msflexpackcontent gatedlandingpageborderbox boxsizing borderboxfgartner colmd7ul libefore light3s transitionli libefore contentfgartner fgartnersingleintensity6 displayfsingleimageexpandendfsingleimagedecorate fsingleimagewrapper0 2em16libefore light darkfgartner colmd6svg color100 paddingflogoswrapper col6fsingleimageexpandend fsingleimagewrapperrelative widthflogostitle darkdark light ficonicontypeaccentaftermsflexitemalign start4remdark fsingleimagedescription darkfsingleimagedescription900px fsingleimageexpandendfsingleimagedecoratefillcubicbezier191221width 5s cubicbezier191221fgartner padding1200px fsingleimageexpandstartfsingleimagedecoratecolsm4zindex 1 auib2bheight 0ficon fragmentseditoreditabletypeimagemsflexbox display flexli positionprofilecardli libeforecolsm5 flogoswrapperrightficonicontypeaccentafter darkficonicontypeaccentafter0 5emul libefore darksvg ficon fragmentseditoreditabletypeimagecol9 flogoswrapper0b63ce ftextcontent ulmargin autolibefore darkfgartner col12 fgartnermarginright 0 overflowdark lightftextcontent ulcubicbezier1001marginleft 35remjournalcontentarticleopacitytransform nonetrainingcourseagenda trainingagendasection trainingagendaitemdark lightflogosrgba1091171288 boxshadow 0ficonicontypesmall fragmentseditoreditabletypeimage heightcolmd11 fgartner colmd10trainingcourseagendaoverflow visible mediaflogoscontainershowbackgroundcolor backgroundcolor f4f6f9listitemwrapperoltype listitembeforeminwidth 1200pxlibefore ftextcontent ulfgartner colmd1 fgartnercolorwhitegatedlogosectioncontainersocialmediaicons0 aui5s cubicbezier191221webkittransformdarkfsingleimagedecoratebackgroundcolor 0d5ab8img ficon1 fsingleimagedecorate fsingleimagewrapperbeforeeaseinoutwebkittransform 25sfsingleimagewrapperbefore lightftextcontent ulalignitems545d69 dark ftextsmallcapsmsflexdirection columnheight 116em ficonicontypesmalllight dark fsingleimagedescriptionfsingleimagedecorate fsingleimagewrapperafter darkcubicbezier191221light fsingleimagedecorate fsingleimagewrapperbeforeopacity 5sgatedlandingpage gatedcontentmediafsingleimageexpandstart marginleftjustifycreatenone margintop 1remboxshadow 0html bodyalignitems center displayheight 05emfhomebannercol3iconimg ficonicontypelargeflogoswrapper col51 fsingleimagedecoratecolor 0b63ce content6px display blockcontentblock padding 0f4f6f9comparisontablehasfeatureiconimg ficonicontypelarge fragmentseditoreditabletypehtmllibefore ftextcontenteaseinout transitioncalc1000 0 875emdark lightftextcontentlightfsingleimagedecorate fsingleimagewrapperaftercolor 0b63ce ftextcontentcontentwrapper contentblock0b63ce borderradius0505 light2s easeinout1em widthfgartner colmd3 fgartnernormal msflexdirection rowftextsmallcaps colorfsingleimagewrapper positionrevenuebleedingmedia bleedingimgwrapper05em maxheightauto ftextheadingheight auto stackanimationcontainer25em 25em5em rgba1091171288textalign center599px fsingleimageexpandstart marginleftwebkittransform 3s06 lightlineheightnone transformfragmentseditoreditabletypehtml ficonicontypesmallformwrapperpaddingbottom 075remitem ftextcontentcubicbezier191221webkittransformul li libefore02em width 1em8pxftextsmallcapsdefault fontsizebleedingmedia bleedingmediacontainermargintop 2rem maxwidthboxsizingmodaldialogfsingleimagewrapperafter borderradius 6pxnormal msflexdirection columnmarginright calclight darkfsingleimagedecorate fsingleimagewrapperbefore116em ficonicontypesmall iconimgsolid rgba25525525511 webkittransitionfsingleimagewrapperbefore lightfsingleimagedecorate116em ficonicontypesmallvisible media minwidthfsingleimagewrapperafter lightfsingleimagewrapperbefore fsingleimagedecoratecolmd4 flogoswrapperdisplay flex webkitboxpack0 widthfsingleimagewrapper marginleft calcmsflexitemalignpaddingleft 15rem ftextcontentflogoswrapper colmd4 flogoswrapper02emeaseinout aui subscriptioncardcol1 flogoswrapper0 paddingunderlinefgartner colsm5marginbottomnormalfgartnersingleintensity5webkittransition opacitycolsm11 fgartner0 rgba1091171281600 4pxaccordionheaderol libefore lightftextcontent05rem positionnormal msflexdirectionflogoswrapper colsm5col9auto marginright autoeaseinouteaseinoutwebkittransform 25s easeinoutvisibilityrgba7676768light ftextsmallcaps darksimplecardhorizontal6pxli counterincrementcolmd12 fgartnerwebkitboxflex 1zindexlight darkficonicontypeaccentafterdigitalmarginleft 0aspectratiostylebackgroundimage urlh2flogoswrapper col4width 1emcomparisontablecomponent comparisontabledesktoponly35s cubicbezier1001colmd3light fsingleimagedescriptiontransition opacitystackanimationcontainer5s cubicbezier191221 transitionlibeforemediacardfgartnerlogo backgroundcolor 0d5ab8ahover textdecorationinsurancecolmd5 flogoswrapper colmd4relative width 100ftextheadingmarginleftautoabsolute ftextcontent ul1em textalign centerfff displayflogoswrapper col2ficon fragmentseditoreditabletypehtml imgbleedingmediatextmarginleft calc 4remabsolute top 501em comparisontablecomponentwebkitboxdirection normal msflexdirectiondark lightficonicontypeaccentafterfsingleimagewrapperbeforerotate45deg transform5em rgba7676768transformmarginright autoflexdirection columnreversewidth 50fgartner colsm11 fgartnerbackgroundcolor 0b63ce ftextcontentficonicontypesmall fragmentseditoreditabletypeimage17ficonicontypeaccentafter1px solid rgba2552552551content counternesteditemcolmd2 fgartnerdisplay none mediadark lightfsingleimagedescriptionposition static webkittransform2a539ebackground fffvalueuppercaseminwidth 1200px fsingleimageexpandendfsingleimagedecorate8px content14fsingleimagewrapperbefore dark lightwebkitboxpack centercolsm1 flogoswrappercolmd54s easeinoutwebkittransform 4snone transform none10pxtransition webkittransform 3smaxwidth 599px fsingleimageexpandstartcol7 flogoswrapper col6fsingleimageexpandend marginleftopacity 2s easeinoutfeatured3webkitbox display msflexbox3s easeinoutdarkfsingleimagedescription599pxitemfsingleimageexpandstart marginleft 15remmsflexaligncolmd70borderradius 2px15rem marginrightlight dark ficonicontypeaccentaftertrainingagendaitemftextcontentlistspacingnone li05em dark ftextcontentfgartner colmd4darkfsingleimagedecorate fsingleimagewrapperbefore backgroundcolorcubicbezier1001 transition05rem maxwidthlight flogos flogostitle1emdark fsingleimagedescription lighthidden paddingnone bleedingmediavar075rem ftextcontent olswiftypesearchinitializedcolmd1 flogoswrapperreverse15rem ftextcontentpaddingbottom 00 fsingleimagedecorate13underline ftextsmallcaps colorwhitecontent heightfgartner fgartnersingleintensity5 displayftextsmallcaps light darkvideocard1125emfsingleimagewrapper zindex 0position relative ftextcontentminwidth 900px fsingleimageexpandstart28pxcolmd4 fgartner colmd3fsingleimage fsingleimagewrapper positionlight flogosflogoswrapper col711nesteditemftextcontentlistspacingnoneaspectratiostylebackgroundimage url imggetattributesrczindex 0 fsingleimagedecoratelight darkftextcontentftextcontent ul liststyleflogoswrapper colsm2transition opacity 5s1 auto webkitboxorientmaxwidth 100 paddingfastersvgflexstart600pxftextheadingtextcenter ftextheadingtextcentertabletportraitup marginleft255 05 lightwebkitboxsizing borderboxfsingleimageexpandendfsingleimagedecorate fsingleimagewrapper marginrightfsingleimageexpandstartfsingleimagedecorate marginleft 1remdarkfsingleimagedescription lightcollg12transition transform 5sborderradius 8pxcolmd5 flogoswrapper15rem mediafgartner fgartnercontentfffall and maxwidth979px0b63cehorizontal webkitboxdirectiondisplay blocklineheight 1389col1ol li counterincrementfgartner fgartneroverlay colorimagesection homebannerimageauivar auifsingleimagedecorate fsingleimagewrapperafter darkfsingleimagedecorate1200px fsingleimageexpandstart fsingleimagewrapperftextsmallcaps light6d7580 textdecorationopacity 1li paddingbottom 0minwidth 900px fsingleimageexpandstartfsingleimagedecorate1em aui subscriptioncarddarkmodeunderline ftextheading colorwhiteiconimg img ficonfragmentseditoreditabletypehtmlinlineblock ftextsmallcapsspan divtranslatex5em transform translatex5emboxshadow5s cubicbezier191221width 5sftextcontent ol ftextcontentnone width1 webkittransition opacity3b5998545d69 function var0875rem lineheight 1389colmd10 fgartner colmd9ul liststylemarginleft 15remsocialmediaicons socialmediaiconscontainercol2 flogoswrapper col1fgartner fgartnerlogo backgroundcolorftextheadingmarginhorizontalauto marginleftmaxwidth 599px fsingleimageexpandstartfsingleimagedecorateyou0b63ce bottomfsingleimagedescription darklibefore heightcolsm6 flogoswrapperfosbspacersubscriptioncardlight darkftextsmallcapsvertical webkitboxdirection normalitem ftextcontent olmaxheight 05remficonicontypeaccentafter light dark25emficonicontypesmall iconimgright 0wrapper1em positionwebkitboxorient horizontal webkitboxdirection055emposition absoluteftextsmallcaps color 545d69fgartner colsm8 fgartnerdark light flogosbackgroundcolor 0b63ce bottomacrosspadding 0 0marginright 1remftextsmallcapsnone comparisontablecomponenttexttransform uppercasectalink paddingflogoswrapper colmd2lightflogos flogostitlecubicbezier191221webkittransform 5s cubicbezier191221flexdirection0 fsingleimagedecorate fsingleimagewrapperbefore50px4s easeinoutwebkittransformcol4 flogoswrapper col3fsingleimagedecorate fsingleimagewrapperbeforemarginbottom 1emwebkitboxalign center msflexalignwebkittransitiontextdecoration underline ftextcontentcolorwhite0b63ce fsingleimagedescription colorfgartner fgartnercol2 displaycubicbezier191221width1px solid545d69 ftextsmallcaps colorwhitelightfsingleimagedecorate fsingleimagewrapperbefore darkinlinecolor ffffff lighttransform translatex50fragmentseditoreditabletypehtml img ficon1 msflex 1display none comparisontablecomponentauto ftextheadingmarginrightauto marginrightcenter msflexalign19ab4f0 1emwebkittransformreverse msflexdirectioncontentwrapper displaycolsm8ftextsmallcapsspan div displayftextcontent ol libeforedxp75emcolmd9 flogoswrapper colmd8auto ftextheadingmarginhorizontalauto marginleftfeaturesfhomebanner imagesection homebannerimage075rem top2rem 1remdark light ftextsmallcapslibefore height 3pxwebkitboxdirectionfragmentseditoreditabletypehtml imgcollg12 fgartner colmd12fsingleimagedecorate fsingleimagewrapperafter lightfsingleimagedecorateonecomparisontablerow bordertopftextheadingmarginhorizontalautocolumnfeaturedflogoswrapper colmd8 flogoswrappercomparisontablerowlastchildsubscriptionpopup0b63ce right05 light fsingleimagedecoratefsingleimagewrapperafter light darkfsingleimagedecoratevar fragmentelementflogos flogoscontainershowbackgroundcolorlight fsingleimagedescription darklight ficonicontypeaccentafter darkdark fsingleimagedecorate fsingleimagewrapperafter1em medialibefore color rgba255backgroundcolor fffcolsm6 flogoswrapper colsm5padding 2rem1200pxdisplay none bleedingmediacontent alertbannerpaddingleft40pxcontentblock webkitboxflex 1imgstyleopacity 0 fosbspacerposition relative mediagatedlandingpageflogoswrapper colmd1ftextheadingmarginleftauto marginleft automedia maxwidth767px600 dark ftextcontentpadding 05remcolsm11fgartner colsm9ftextheadingtextcenterbackgroundcolor 2a539ecalclight darkftextcontent olflex webkitboxpack centercomparisontablegrouplabel2px heighttrainingcoursebannerlinkcontainercourseinfowrappercolorwhite ahover textdecorationcolsm6 fgartnerpadding 5emmoderntextdecoration none ftextsmallcapsspan2emlightftextsmallcaps darkdarkfsingleimagedescription colorvertical webkitboxdirection reverseflogoswrapper colsm2 flogoswrappercolorpadding 05rem positionwebkittransition opacity 5sfgartnerlogo0b63ce right 05remcolsm3 fgartner colsm2transform rotate45degeaseinout aui subscriptioncardhover1rem paddingleftcolor 545d69 dark02em widthfgartner colsm8fgartner colmd7 fgartnerrelative width calc100vertical webkitboxdirectionlight ficonicontypeaccentafter lightficonicontypeaccentafterrgba1091171288content counteritem fontweight0 rgba109117128160 5emconfigurationficonicontypelarge1200px fsingleimageexpandstartauto ftextheadingmarginrightautobackgroundcolor 0b63ce rightlightftextsmallcaps color 545d69fsingleimageexpandendfsingleimagedecorate0875rem lineheighthorizontal4rem 155pxsvg displayleft calc50columnenterprisewhitespace nowrapmaxwidth 600pxcolsm3 flogoswrapperbordertransform 5sstaticmedia minwidth 1200pxol libefore darkftextcontentcolsm4 flogoswrappercolsm3 fgartnercolmd2ficonicontypesmallcomplexftextcontentlistspacingbasefunction varcontent banner topli ftextcontent uliffgartner colsm9 fgartnerlistitemftextheadingmarginleftauto marginlefttop 50webkitboxalign0675em ftextcontentfsingleimageexpandendfsingleimagedecorate marginright 0backgroundcolorfgartner colmd4 fgartnerfunctioneventcolsm6fragmentelementqueryselector aspectratioobjectfitcovercolsm5 flogoswrapper colsm415rem position absolutemarginbottom 0 auifosbspacer heightcolmd4 fgartnerquotecontainer quotetext color15remcolmd1flogoswrapper col1div displayheight 02emcol5display flex webkitboxflexfontsizefsingleimagewrapperafter backgroundcolor 0b63celi ftextcontent0b63ce content counteritemdisplay block heightmarginbottom 5emcolsm2 fgartner colsm1display inlineblock ftextsmallcapsspan5sftextheading marginbottommodalbackdropflogoswrapper col8aspectratioobjectfitcover varvar img aspectratioqueryselectorimgfgartner collg12dark ficonicontypeaccentafter lightcookievaluefgartneroverlay display3px leftsinglestart alignself flexstartcalc 4rem075rem top 0675em1200px fsingleimageexpandendfsingleimagedecorate marginrightimg ficon iconimg6d7580 textdecoration underlinecomparisontablegroupwebkittransform rotate45degtextdecoration noneftextsmallcaps colorwhite ahover599px fsingleimageexpandstartfsingleimagedecoratecolmd10 fgartnertransform translatex5emlibefore lightftextcontent ulfsingleimageexpandstartfsingleimagedecoratemsflexdirectiontranslatex50underline ftextcontentcolorwhitemarginbottom 0 ftextheadingmarginleftauto0d5ab8lightfsingleimagedecoratefgartner colmd6 fgartnermodalheaderimg aspectratioqueryselectorimg aspectratiostylebackgroundimagefgartner colsm2textaligninfogroupflogoswrapper colmd4marginright 15rem mediacol5 flogoswrapper col4column flexdirectionol li ftextcontentflogoswrapper colmd5 flogoswrapperbleedingmediavideoli counterincrement item1rem media minwidthbackgroundcolor f4f6f9counteritem fontweight 600h1 ftextsmallcapsdefault h225s easeinoutwebkittransformsimplecard contentwrapper0 ftextheadingmarginleftauto marginleftfsingleimagedecorate fsingleimagewrapperafter borderradiusmargin 1emcoverliststyle none margintopflogoswrapper colsm6 flogoswrapperfsingleimagewrapper marginrightwidth25s easeinoutcolmd65pximgcomparisontabledatacolsolutionstransition transform155px media minwidth1pxcolumnreverse flexdirection columnreversecolumn flexdirection columnfsingleimagewrapper zindex155pxmsflexdirection row flexdirectioncolmd4 flogoswrapper colmd3gatedlandingpage formwrapper545d69 dark fsingleimagedescriptionexperience platformfsingleimagewrapperbefore backgroundcolorh1 ftextsmallcapsdefault2s0 fosbspacergatedlogosection gatedlogosectiontitle15rem positioncolsm8 flogoswrapper5em aui900px fsingleimageexpandstartdarkflogos flogostitle2em positionfsingleimagewrapperafter borderradiuslightfsingleimagedescription colorfsingleimagedecorate fsingleimagewrapperbefore lightabsolute transform translatey50libefore backgroundcolor0 comparisontablecomponentmaxwidth 100truepadding 0relativelight darkflogosemployeesdisplay msflexboxinlineblock ftextsmallcapsspanfgartner colsm6 fgartnerwebkitboxdirection reverse msflexdirectionlight ftextcontent ulborderradius 25em055em width 05emfsingleimagewrapperbefore darkfsingleimagedecorate fsingleimagewrapperbeforeaui subscriptioncardhoverfsingleimagewrapperafter darkfsingleimagedecoratecolmd2 flogoswrapper colmd1ficon iconimg svgsubscriptionpopupmodalflogoswrapper colsm4col2 flogoswrapperwebkittransform translatey0ahoverhomebannerimagecolmd9 fgartnerfgartner colmd2 fgartnermodalinnerhtmlhave0077b5leftbleedingmediavideo displayfsingleimagewrapperaftermaxwidth 05rem175emflex webkitboxorient verticaldisplay none4accordiongenericcontaineropenftextheading colorwhite ahovernone fosbspacer height1 flex 10b63ce fsingleimagedecoratesupportvisible media05rem top 05remdisplay block margintopflexdirection columnvisibility hiddensvgsocialmediaiconslightauto marginright05 light ficonicontypeaccentafter255 06 lightfgartner colmd10 fgartnercol6 flogoswrapperminwidth 600pxnone media maxwidthftextheading colorwhiteaccordiongenericcontainercontent counteritemcolsm1 fgartnertop 0675emfff borderradiuscolor 545d69partners0875remli ul paddingleftstatic webkittransform nonecounteritemautoflogoswrapper col1 flogoswrapperflexall and maxwidth767pxflogoswrapper colmd7 flogoswrapper9bleedingmedia bleedingmediacontainerhoverfgartner colmd3productftextcontentcolorwhite ahover textdecoration075rem ftextcontentlistspacingnone li15rem marginright 15remfsingleimagewrapperafter backgroundcolor rgba2550 0flogoswrapper col4 flogoswrapper1200px fsingleimageexpandend marginrighteaseinout auicolmd7 fgartner colmd6paddingflogoswrapper colmd3 flogoswrappercenter alignitemslightficonicontypeaccentafterftextsmallcaps lightftextsmallcaps545d69fgartner colmd1darkfsingleimagedescription color ffffffgatedlogosection gatedlogosectioncontainerlibefore backgroundcolor 0b63cetop 0fhomebanner textsectioncloseiconimg ficonicontypesmall fragmentseditoreditabletypehtmlanimationcardhelpcol2fsingleimagedecorate fsingleimagewrapperbefore lightfsingleimagedecoratebleedingmediableedingmediaenlargevideocomparisontablecomponent comparisontablehasfeaturecolor 545d69 function50 position absolute1389 ftextsmallcaps50 transformdarkficonicontypeaccentafter backgroundcolorbackgroundfhomebanner imagesection playbuttondarkfsingleimagedecorate fsingleimagewrapperafter backgroundcolorfgartner collg12 fgartnerunitedcolmd7 flogoswrapper25s75px mediacolmd8contentwrapper widthcoursefeatureswrapper featuregroupcontentblock webkitboxflexverticalabsolute ftextcontentpadding 1emauto ftextheadingtextcenter ftextheadingtextcentertabletportraitupdark light fsingleimagedescriptionimg aspectratioqueryselectorimgfontweight 600flogoswrapper colmd5backgroundcolor 0b63ce fsingleimagedescriptionlightftextcontentdark lightftextsmallcapsgatedcontentmediasocialmediaiconscontainervar auivar0 html100 ficonicontypelargemsflexalign centerdarkfsingleimagedecorate fsingleimagewrapperafter lightbackgroundsize cover50px rgba916291alignself flexstartfsingleimagewrapperafter lightfsingleimagedecorate fsingleimagewrapperafterfgartner padding 2remsupportscssobjectfitnone ftextcontentlistspacingbasefgartner colsm11svg display blocklibefore darkftextcontent olcol12rgba767676160255 05background fff borderradiustrainingbannerlight ftextsmallcaps3em05rem maxwidth 05remmarginleft 1remeaseinoutwebkittransform 4ssupportscssobjectfit varcomparisontablerowol libefore colorcolsm12fragmentseditoreditabletypeimage svgrgba2552552551darkficonicontypeaccentafter light darkficonicontypeaccentafterfunctionpadding 0 2emficonicontypesmall fragmentseditoreditabletypehtmlwebkitboxorientmsflexbox displayfgartner fgartnerlogodisplay inlinewidth 100 flogoslogoflex 16px displaycardbottomtextcontainerlight darkficonicontypeaccentafter backgroundcolorfsingleimagedecorate fsingleimagewrappercolor 0b63cemaxwidth767pxwebkitboxsizing borderbox boxsizingfragmentnamespacefsingleimagedecorate fsingleimagewrapperafterurlfsingleimagedecorate fsingleimagewrapperafter backgroundcolorvar configurationcolor 09101dmsflex 1subscriptiontooltiptriangle2rem maxwidth875em 0 rgba109117128160fgartneroverlay display noneopacity 2sfsingleimageexpandstartfsingleimagedecorate marginleft 0ul paddingleftwebkitboxorient vertical webkitboxdirectionminwidth 900px fsingleimageexpandendfsingleimagedecorate06 light ftextcontentcardinitialtextmarginright 35remfgartner colmd10ficonicontypelarge iconimgmarginright auto ftextheadingtextcenterfragmentseditoreditabletypehtml ficonicontypesmall fragmentseditoreditabletypeimage1em 0borderradius 0lightfsingleimagedescription darkfsingleimagewrapperbefore dark lightfsingleimagedecoratecubicbezier191221 transitionftextheadingtextcentertabletportraitup marginleft autobusiness545d69 ftextsmallcapsrotate45deg transform rotate45degmsflexpack centerdisplay webkitbox12media minwidthftextcontentlistspacingbase li paddingbottomftextcontentlistspacingbase liaui subscriptioncardservicescolsm10 fgartner colsm9col7 flogoswrapperauto ftextheadingtextcentercontent bannerftextsmallcapsspan divlibefore light darkftextcontent0b63ce bottom 05remcolmd3 flogoswrapper colmd2flogoswrapper col2 flogoswrappercolmd12ficonicontypelarge fragmentseditoreditabletypeimageurl imggetattributesrc imgstyleopacitymarginleft 1rem marginrightlibefore content displayequipcounterincrementli liwhitespacedarkfsingleimagedecorate fsingleimagewrapperafterbackgroundcolor 0b63ce borderradiusmargintop3px left 075remfsingleimageexpandendfsingleimagedecorate marginleftcomparisontablerowlabel displayvar fragmentnamespacemenusetattributestyle maxheightborderbottom 1pxquotewrappertitlefsingleimagewrapperafter backgroundcolor0b63ce ficonficonicontypelarge fragmentseditoreditabletypehtml ficonicontypelargecalc100vwpadding 5em 0ftextsmallcapsspan display inlineblockwebkittransform none transformopen5s cubicbezier191221widthbordertoprgba255col6libefore dark light92px zindex 1nesteditem ftextcontent olficon iconimg imgborderradius 6px displayyourfsingleimagewrapperafter light darkcolsm9 fgartner colsm8liststyle none1200px fsingleimageexpandstart marginleftcolmd6 flogoswrapper colmd52px height 05emwebkitboxdirection reverse1 1 automargin 0 5em1rem paddingleft 15remdark ficonicontypeaccentaftercenter msflexpack centerdarkftextsmallcaps light darkftextsmallcaps5smaxwidthcolsm2 flogoswrapper colsm1fragmentseditoreditabletypehtml ficonicontypelargefsingleimagedecorate fsingleimagewrapper zindex0 fosbspacer height875em 0flogoswrapper colmd9height 116emficonicontypelarge fragmentseditoreditabletypehtmlfgartnercol2 display nonepaddingbottom 075rem ftextcontentlistspacingnonerowright 05reminline fosbspacerblock height100 flogoslogomaxwidth 599px fsingleimageexpandendnone fgartnermaxwidth979px4px media minwidthbackgroundcolor 0b63ce fsingleimagedecorateunderline ftextheadingcomparisontablelibefore darkftextcontent ulfsingleimageexpandend marginleft 15rem05rem left 05remtransition transform 3sfsingleimageexpandstart marginleft calcdark light ftextcontentposition absolute transformmedia minwidth 900pxnone ficonicontypeaccentafter backgroundcolorftextcontent ol li3scenter displayfgartner colsm6help youdigital experiencecounterincrement nesteditem ftextcontentol ftextcontentheight 02em widthtop 05remli libefore heightcalc 4rem 75pxftextsmallcaps darkstackanimationcontainer animationcardhovercontentwrapper display webkitboxalertbanner display0b63ce ftextcontent olul paddingleft 075remhtml content alertbannerfsingleimagedescriptionlight ftextcontent ol8emmarginrightflogoswrapper colmd2 flogoswrapperflogoswrapper colsm84rem 4pxfgartner fgartnersingleintensity5col3 flogoswrapper col2059824857654622696 17734644backgroundcolor rgba255 255fsingleimage fsingleimagewrapperflogostextdecorationftextcontentcolorwhitetop 055emfragmentelementblock leftfgartnerdescription margintop 1remborderradius 6pxrelative ftextcontent0 rgba767676160 5emwidth 92px zindexhomebannerdescriptionfgartner colsm5 fgartnerdisplay flex heightsupportscssobjectfit var aspectratioposition relative width0b63ce ficon iconimgmaxwidthdark fsingleimagedecorateaspectratio875em 0 rgba7676761600 ftextheadingmarginleftauto4rem 75px medialightfsingleimagedecorate fsingleimagewrapperbefore backgroundcolorrotate45deg2rem maxwidth 100svg webkittransformflogoswrapper col3 flogoswrapperminwidth 900px fsingleimageexpandendrgba109117128160 5em 1125emvar auivar auilistitembeforeol ftextcontent ulflex webkitboxorientfeaturegroupfhomebannerbtnffffff fhomebannercolsm3 flogoswrapper colsm2900px fsingleimageexpandstartfsingleimagedecorateh2 ftextsmallcapsdefaultlightfsingleimagedecorate fsingleimagewrapperbeforeol li libeforeimg ficon fragmentseditoreditabletypehtmlflex heightflogoswrapper col5 flogoswrappercolmd5 fgartner colmd4color 6d7580dark ftextsmallcaps lightul li ulaspectratio fragmentelementqueryselectorcomparisontablecomponent comparisontablefhomebanner fhomebannerbtnbleedingmediacontainer enlargebuttonftextsmallcapsdefault fontsize 0875remol libefore darkli ulcenter display flexolauto stackanimationcontainerbanner topfontweight 400fsingleimagewrapper marginleftcolsm5 fgartnerinlineblockftextsmallcaps lightftextsmallcaps darkdark ftextcontent olwebkittransform translatey0 transformlibefore dark lightftextcontentcontent displaylightfsingleimagedecorate fsingleimagewrapperafter darkftextcontent ul licolsm8 fgartnerlightficonicontypeaccentafter dark0 overflow visiblehtml content gatedlandingpageusmsflex 1 flexlightfsingleimagedecorate075remaspectratioobjectfitcover var imgftextcontentlistspacingnone li paddingbottom35rem media maxwidtheaseinout transition opacitylineheight 1389 ftextsmallcapsftextheadingmarginhorizontalauto marginleft auto25em 5emdark ftextsmallcaps darkftextsmallcapsficonicontypeaccentafter backgroundcolorcolsm7 flogoswrapper colsm6fgartnercol2colmd7 flogoswrapper colmd6fsingleimageexpandend marginrightfsingleimagedisplaycenter msflexpack5s cubicbezier191221webkittransform 5s0 overflowcolsm5 fgartner colsm4fsingleimageexpandend fsingleimagewrapper marginlefthomebannerdescription maxwidthliferay dxp09101dfragmentseditoreditabletypeimage heightwebkittransform translatex5em transformtextdecoration none ficonicontypeaccentafter900px fsingleimageexpandstart fsingleimagewrapperbody content darkmodemargintop 2remmarginleft auto ftextheadingmarginhorizontalautoeaseinoutwebkittransform 4s easeinoutmarginleft 15rem marginrightanimationcardhoverpaddingleft 075rem0 aui subscriptioncarddarkfsingleimagedecorate fsingleimagewrapperbeforecenter msflexalign centerflogoswrapper col6 flogoswrapperpartnerlibefore lightftextcontentlightficonicontypeaccentafter dark lightficonicontypeaccentafter1em position relative599px fsingleimageexpandend marginleftstatescolsm1listitemwrappermodaldialog modalcontentalignselffsingleimageexpandendfsingleimagedecorate marginleft 1remopacity 1 webkittransition100 zindexlightflogosfgartner col12light ficonicontypeaccentafterlibefore darkftextcontentcounternesteditem ftextcontentcolorwhiteclouddark lightftextcontent ol0 4px 50pxstart1200px fsingleimageexpandstartfsingleimagedecorate marginleftfgartner colsm3 fgartner15em2pxfragmentseditoreditabletypehtml svgwidth 92pxanimationcard contentblockcolsm12 fgartnercomparisontablegroupfirstchildheight autoborderradiusol libeforecalc 4rem 4pxallcomparisontablegrouplabel displayfgartner colsm1035rem fsingleimagedecorate3pxbackgroundcolor fffffffsingleimageexpandendpadding 0 1emrelative ftextcontent olsvg fhomebannerauto webkitboxorient verticalenglish5em positiontop 0675em ftextcontentborderradius 6px contentfsingleimagewrapperafter dark lightficonflogoswrapper colsm3 flogoswrapper05em darkwebkitboxdirection normaltransform 5s cubicbezier191221widthalignitems center1em dark ficonicontypeaccentafterflogoswrapper colsm74scolsm8 fgartner colsm7position staticlibefore content0 marginright05rem top 055emvar aspectratiodisplay flexvideolight darkftextcontent ulftextcontentcolorwhite a colorrelative topvar imgwebkitboxshadow 0colmd12 fgartner colsm12fhomebanner imagesectioniconimg svg ficonmarginright auto ftextheadingfragmentseditoreditabletypeimageftextsmallcaps dark lightsuccessfsingleimagedescription lightsocialmediaiconsdarkdark flogosdarkftextcontent olcenter justifycontent centertranslatey50col8 flogoswrapperbottomposition absolute width30px0b63ce fsingleimagedescriptionol li li1125em 5em rgba109117128892px0b63ce borderradius 2pxdark fsingleimagedescriptiontranslatey0english united states16pxfragmentseditoreditabletypeimage svg displaywebkittransform translatex50top 055em widthmsflexdirection columnreverse flexdirectionmsflexalign center alignitemscolorwhite a color1 1html contentcustomerszindex 1 fsingleimagedecorate1 auto flex1200px fsingleimageexpandend fsingleimagewrapper15rem ftextcontent olpaddingtopli counterincrement nesteditemulbleedingmediaimgvisibility visiblelightftextsmallcaps colordarkftextcontent ulmarginleft 0 overflow1389 ftextsmallcaps colorwebkitboxpaddingbottom 1emquotecontainerimggetattributesrcdarkflogoscol6 flogoswrapper col5light ftextsmallcaps lightftextsmallcapsabsolute width 92pxbodyjustifycontentgatedcontentmediabeforecol3 flogoswrapperlight darkfsingleimagedecoratesocialmediaiconslightcol5 flogoswrappercalc100vw 3emctalink padding 0transform translatey0libefore content counternesteditem0 marginright calccenter justifycontentflogoscontainershowbackgroundcolorimg ficon fragmentseditoreditabletypeimagecol9 flogoswrapper col8opacity 0aspectratiostylebackgroundimagelibefore color 0b63ce0675em ftextcontent ullight darkftextsmallcaps colorfgartnerdescriptionfsingleimagewrapper marginleft 35remborderbox boxsizingfsingleimagedescription light darkimagesection1em darkfgartner fgartnercol20d5ab8 borderradius 6pxcomparisontablecomponentftextsmallcapsspan display6d7580colmd8 fgartner colmd7fgartner colsm7height 3pxficonicontypeaccentafter dark light48pxwebkitboxalign centerfgartner colsm4bleedingmediacontainerhover255 255 058webkittransition webkittransform 3sheight 2s easeinoutwebkitboxflex1125em 5em rgba7676768colmd8 flogoswrapper colmd7col45s easeinoutfsingleimageexpandend marginright calcwidth 100marginright auto ftextheadingmarginrightauto0 rgba767676160subscriptioncard subscriptiontagflogoswrapper col3counteritem fontweightdivfgartnercontentabsolute right6px content heightb2b commercedarkficonicontypeaccentafter backgroundcolor rgba2552ficon fragmentseditoreditabletypeimage imgbackgroundcolor 19ab4fsidebarmoleculedisplay block lefttransitionmaxwidth 599pxdarkftextcontentfsingleimagewrapperafter dark6px contentcomparisontabledesktoponlycolumnreversequotetext colorctalink svgwidth 100 zindexlibefore lightftextcontent olhidden2remheight 2s5em rgba1091171288 boxshadow9pxcolsm10rgba767676160 5em 1125emftextsmallcapsspanrgba916291bottom 05remmarginbottom 01rem marginright 1rem05rem darkwebkitboxpacklibefore backgroundcolor rgba2555em 0minwidth 900pxcolor 6d7580 textdecorationcounterincrement nesteditemsubscriptioncard subscriptionitemwrappersvg webkittransform translatex5emmsflexitemalign start alignselfcol8 flogoswrapper col7gatedlogosectiontitlenone ftextcontentlistspacingbase li75pxftextheadingfsingleimagewrapperafter dark lightfsingleimagedecoratefmodal modaldialog modalcontentauicolumnreverse flexdirectiontransform none width075rem ftextcontentconst05remmanagementfsingleimagedecorate fsingleimagewrapperbefore darkfmodal modaldialogiconimg svgblock height 100ul libefore0 padding 0paddingrightlight darkbuildpaddingbottomfgartner colmd12trainingvideocollectionfragmentseditoreditabletypehtml ficonicontypelarge fragmentseditoreditabletypeimagebleedingmediacontainerbetterflogoscontainer545d69 darkcolsm5subscriptioncard cardbottomtextcontainerfgartner colsm3fgartneroverlay color4rem 75pxsvg ficon0 position relativeenglish unitedwidth 5ssubscriptioncardhoverwidth 100 comparisontablecomponent4px 50px rgba916291flogoswrapper colsm9auto webkitboxorientul libefore darkftextcontentcoursefeatureswrapperfgartner colsm12 fgartnerposition absolute rightauto flex 1059824857654622696599px fsingleimageexpandstartfsingleimagedecorate marginleftunited states5s transitionmarginright calc 4remurl imggetattributesrcfgartnerimagesectionaui subscriptioncard subscriptiontagnone margintoptrainingcomponentschemecardmsflexboxminwidth 1200px fsingleimageexpandendauto ftextheadingmarginhorizontalautocolor fff displaycollg12 fgartnerhorizontal webkitboxdirection normalcomparisontablerowlabelcenter alignitems centerleft 0colmd4colsm7 fgartner colsm605rem position absoluteficon fragmentseditoreditabletypehtml svgfgartner colmd12 fgartnercolor fffflogoswrapper colmd6 flogoswrappercubicbezier191221width 5smarginbottom 2emsubscriptiontaglight ftextcontentdisplay webkitbox displayborderradius 8px contentwebkitboxshadowdark lightficonicontypeaccentafter backgroundcolorcontentrelative media1em simplecardhorizontaltop 0 widthheight 058emfsingleimageexpandendfsingleimagedecorate marginrightwebkittransform rotate45deg transformfragmentseditoreditabletypeimage height 116emimgstyleopacity 0fgartner fgartnerimagesectionmedia allfgartner colsm1 fgartnerdark light fsingleimagedecorateebookleft 05rem5em widthlight dark flogosmsflexdirection column flexdirectiontextdecoration none ftextcontentlistspacingbasecolmd6 flogoswrappercenterwidth 100 bleedingmediacontent counternesteditem ftextcontentcolorwhitehtml hasalertcontainercolor 545d69 ftextsmallcapswidth 05emflogoswrapper colmd7ftextsmallcapsdefault h2 ftextsmallcapsdefault0d5ab8 borderradiuscolsm7 fgartnerheightaspectratioqueryselectorimg aspectratiostylebackgroundimagetransform translatey5005emsvg ficon fragmentseditoreditabletypehtmlflogoswrapper colsm4 flogoswrapperahover textdecoration none0b63ce ftextcontentnone width 10035rem mediargba255 255colsm7 flogoswrapperwebkittransition webkittransformleft 15remmsflexpack center justifycontentminheightcomparisontablerowlastchild borderbottom875emmarginleft auto marginrightleft 075rem topflogoswrapper colsm1 flogoswrapperflogoswrapper colsm6li position relativetextsectionpaddingleft 15remminwidth 1200px fsingleimageexpandstart545d69 functionlistitemwrapperoltypelightfsingleimagedescription dark lightfsingleimagedescriptionfsingleimagewrapperbefore backgroundcolor 0b63cenoneiconimg ficonicontypesmallmsflex 1 1contact600px col9counterincrement item ftextcontentspandark lightfsingleimagedescription colorficonicontypelarge fragmentseditoreditabletypeimage heightmodaldialog modalcontent modalheaderdigital experiences600 darkbackgroundcolor fff borderradiuscolmd5 fgartner1200px fsingleimageexpandendfsingleimagedecorate154rem 4px media0 positionflexdirection rowmedia maxwidth 599pxmargintop 1rem4pxul lifsingleimagedescription darkfsingleimagedescription lightcolmd9translatex5emcenter mediapaddingbottom 5emquotetextblock height 02emmodalcontentnowrap100 animationcardbackgroundcolor 0b63ce ficontop 2emtopbackgroundcolor rgba255cubicbezier191221width 5s cubicbezier191221webkittransformfsingleimagedescription lightfsingleimagedescriptionoverflow hiddenctalink colorwebkitbox displayblock3s easeinout transitionfsingleimagewrapperbefore light darkfsingleimagedecorateletterspacingquotecontainer quotetextftextcontent ul libeforeflogostitlebanner055em widthaspectratio fragmentelementqueryselector aspectratioobjectfitcoverstart alignselfdark lightftextsmallcaps colorliferay1 msflexenddarkftextcontent ul libeforeul li position5s easeinout transitionmaxheight058em599px fsingleimageexpandendzindex 0height 0 liferayfontsize 0875rem lineheightcolor rgba255 255fgartner fgartneroverlay displaycalc50selfservicehasalertcontainerrow flexdirectionimggetattributesrc imgstyleopacity1 flexconnectiefragmentelementqueryselectorfsingleimagedecorate fsingleimagewrapperafter light15swaycubicbezier191221webkittransform 5smsflexfragmentseditoreditabletypehtml svg ficoncolor ffffffftextheadingtextcenter ftextheadingtextcentertabletportraitupvisiblefunction var configuration5s easeinout auiflogoswrapperaspectratioqueryselectorimgftextsmallcaps darkftextsmallcaps lightcolsm9height 3px lefttrainingagendasection trainingagendaitem24px900px fsingleimageexpandendfsingleimagedecorate fsingleimagewrappercolmd3 fgartner50 position1rem colmd5fgartner colmd8fsingleimagewrapperbefore fsingleimagedecorate fsingleimagewrapperafterfontsize 0875remcommercetop 05rem darkcolsm12 fgartner col12underline ftextcontentcolorwhite ahovercolmd1 fgartnersubscriptionitemwrapperfgartnersingleintensity5 displayul libefore contenttop 50 transformgatedlandingpagedarkmodeflogoswrapper col7 flogoswrapperliul liststyle noneourheight 92px positionoverflowcommunityaui subscriptioncard cardbottomtextcontainermarginright 15rem1em textalignfsingleimagewrapperbefore darkfsingleimagedecoratefontweighteaseinout visibilityhtml body contentheight 05em maxheightmarginright 35rem fsingleimagedecorateheight 92px4px mediapressstackanimationcontainer webkitboxorientcolsm7webkitboxorient horizontalcolmd11lightficonicontypeaccentafter backgroundcolorlatestdarkfsingleimagedescription light darkfsingleimagedescriptionrgba2552552555body contentleft 15rem position0 0 1emcolsm8 flogoswrapper colsm7digital experience platform92px positionmsflexdirection columnreversetextdecoration underline ftextheading75px media maxwidthcol1 flogoswrapper colsm9company5em 1125emauto ftextheading colorwhitefsingleimagewrapperbefore darkffffff light fsingleimagedescriptionmodalbackdrop backgroundcolorcubicbezier191221 transition transformfsingleimagewrapperafter lightfsingleimagedecoratedark ftextcontent ulquotecontainerbeforeplatform116emdarkftextcontent ol libeforefhomebanner homebannerdescription0 875em 0dark ficonicontypeaccentafter darkficonicontypeaccentaftercolsm9 flogoswrapper25s easeinout transitionaccordiongenericcontainer accordionheaderdark flogos flogostitlewebkittransform translatex5emflex webkitboxpack1remmenusetattributestyleffffff light ftextsmallcapsmedialight darkfsingleimagedescription colorminwidth 600px col9colmd8 fgartnerfgartner fgartnerdescription margintopleft 075remposition absolute ftextcontentcontentwrapperblock margintop 2remcolsm2 fgartnerposition relative topgartnerright 05rem topfsingleimageexpandstart fsingleimagewrapper marginlefttextdecoration none fosbspacerflogoswrapper colmd3f4f6f9 borderradius 4pxmedia maxwidth979pxficonicontypelarge iconimg ficonicontypelargelibefore color05rem topmodalcontent modalheadertrainingagendasectiontextalign center media0b63ce fsingleimagedecorate fsingleimagewrapperafterftextsmallcapsdefaultaspectratioobjectfitcoverfgartnerftextcontentcolorwhite ahover0 1em 1empaddingleft 0ficonicontypesmall iconimg ficonicontypesmallficonicontypeaccentafter lightficonicontypeaccentafterficonicontypeaccentafter backgroundcolor 0b63cediv display inlinedarkfsingleimagedecorate fsingleimagewrapperbefore lightwebkitboxflex 1 msflexflogostitle backgroundcolorcolsm4 fgartner colsm3absolute transformalertbannernewdisplay flex webkitboxorientleft 50li li counterincrementfsingleimagedecorate fsingleimagewrapperbefore fsingleimagedecoratecounternesteditemdarkftextsmallcaps colorworkul libefore lightftextcontentmarginleft auto100 comparisontablecomponentjustifycontent centerplaybuttondarkficonicontypeaccentafter lightabsolute topcolsm2texttransformftextheadingmarginrightauto marginright autobestfsingleimagewrapper marginleft 0blogfgartner colsm7 fgartnercol8flogoswrapper colsm7 flogoswrapperftextheading marginbottom 0trainingcourseagenda trainingagendasectiongatedlogosection35s cubicbezier1001 transition0 0 0borderradius 4pxfsingleimagedescription dark light0 875em5em 1125em 5emflogoswrapper colsm9 flogoswrapperh1content height 92pxflex webkitboxflexfsingleimagewrapper marginright 35remdisplay msflexbox displaymaxheight 05rem maxwidthtrainingbanner trainingcoursebannerlinkcontainerstackanimationcontainerhoverwebkittransform 3s easeinout100 ficonicontypelarge iconimgexperiencestranslatex5em transform0 liferay92px position absolute06fsingleimagedescription lightfsingleimagedescription darklightftextcontent ulheight 100webkitboxorient vertical0 width 1004px 50pxftextcontent olcolmd2 flogoswrapperfragmentseditoreditabletypeimage imgftextsmallcaps colorwhite7calc 4rem 155px5backgroundcolor 0b63cemarginright 0width 5s cubicbezier191221webkittransformwebkitboxsizingdarkintotranslatey0 transformcolorwhite ahoverdarkftextsmallcaps color ffffff1rem marginrightfgartner colmd9 fgartnericonwrappervar aspectratio fragmentelementqueryselectorlight fsingleimagedecorate fsingleimagewrapperafterflogoswrapper colsm31 auto05rem leftbottom 05rem leftfsingleimagedescription darkfsingleimagedescriptionftextheadingmarginrightauto marginrightcolsm11 fgartner colsm10nesteditem ftextcontentfgartner colsm10 fgartnerabsolutefgartner colsm4 fgartnerfmodalcontentblock paddinglight darkfsingleimagedecorate fsingleimagewrapperafternone ftextsmallcapsspananalyticsleft 05rem darkjournalcontentarticle cardhoverfgartner fgartneroverlay900px fsingleimageexpandend fsingleimagewrapperfragmentseditoreditabletypeimage height 058em255 255 06borderradius 2px heightanimationcardanimationcarddarkmodeletterspacing 1pxcolmd3 fgartner colmd2schemecardsvgsocialmediaiconsdarkrow flexdirection rowlightftextcontent ul libeforeul libefore backgroundcolorwidth 100 animationcardcolor 0b5fffexperiencectalinkficon fragmentseditoreditabletypeimage svg15rem media minwidth05em maxheight 05remfgartnercol2 displayflogostitle lightflogoswrapper colmd6msflexpackhtmlfsingleimagedecorate fsingleimagewrapperbefore backgroundcolorsimplecardftextheadingtextcentertabletportraituplight dark fsingleimagedecoratelight darkfsingleimagedescriptionfgartner colsm1none medialight dark ftextcontentcol4 flogoswrapperfgartner colsm121rem colmd5 fgartnertransform 3sopacity 5s easeinout1auto flexmarginleftcolmd1 fgartner colsm50 25emportletcolsm4 fgartnerposition absolute topfgartneroverlayfsingleimagewrapperbefore backgroundcolor rgba255aspectratioqueryselectorimg aspectratiostylebackgroundimage urlcolsm4 flogoswrapper colsm3flogoswrapper colsm5 flogoswrapper1em auilightftextcontent olstatic webkittransformcolmd6 fgartnerimggetattributesrc imgstyleopacity 0bleedingmedia177346440 webkittransitionunderline ftextsmallcapspositionabsolute widthdarkftextsmallcaps light

Longtail Keyword Density for Liferay.net

KeywordsOccurences
f-text-content ul libefore36
f-text-content ol libefore36
ahover text-decoration none24
f-text-content ol li24
6d7580 text-decoration underline24
color 6d7580 text-decoration24
-webkit-box-direction normal -ms-flex-direction24
display -ms-flexbox display24
-ms-flexbox display flex24
-webkit-box display -ms-flexbox24
display -webkit-box display24
margin-left auto margin-right23
auto margin-right auto23
rgba255 255 25521
-webkit-box-orient vertical -webkit-box-direction21
media min-width 1200px20
ul libefore background-color18
-ms-flex-direction column flex-direction18
f-text-content ul li18
column flex-direction column18
media min-width 900px18
normal -ms-flex-direction column18
vertical -webkit-box-direction normal18
color-white ahover text-decoration18
color-white a color18
ol libefore color18
255 05 light15
255 255 0515
background-color rgba255 25515
media max-width 599px15
1 1 auto14
background-color 0b63ce border-radius13
content display block13
position absolute top13
dark f-text-content ul12
f-osb-spacer height 012
lightf-text-content ol libefore12
ol libefore dark12
light f-text-content ol12
darkf-text-content ol libefore12
ol libefore light12
dark f-text-content ol12
libefore color 0b63ce12
libefore dark lightf-text-content12
dark light f-text-content12
libefore dark light12
ul libefore light12
light f-text-content ul12
ul libefore dark12
libefore light dark12
lightf-text-content ul libefore12
libefore background-color 0b63ce12
light dark f-text-content12
darkf-text-content ul libefore12
libefore light darkf-text-content12
display block height12
f-text-heading color-white ahover11
margin-right auto f-text-heading11
f-text-headingtext-center-tablet-portrait-up margin-left auto11
f-text-headingtext-center f-text-headingtext-center-tablet-portrait-up margin-left11
auto f-text-headingtext-center f-text-headingtext-center-tablet-portrait-up11
auto f-text-headingmargin-horizontal-auto margin-left11
f-text-headingmargin-horizontal-auto margin-left auto11
text-decoration underline f-text-heading11
f-text-headingmargin-right-auto margin-right auto11
underline f-text-heading color-white11
f-text-heading margin-bottom 011
auto f-text-headingmargin-right-auto margin-right11
margin-bottom 0 f-text-headingmargin-left-auto11
0 f-text-headingmargin-left-auto margin-left11
f-text-headingmargin-left-auto margin-left auto11
margin-right auto f-text-headingmargin-right-auto11
margin-left auto f-text-headingmargin-horizontal-auto11
margin-right auto f-text-headingtext-center11
auto f-text-heading color-white11
-webkit-box-sizing border-box box-sizing11
border-box box-sizing border-box11
5s cubic-bezier191221 transition10
color ffffff light10
1 -ms-flex 110
-webkit-box-flex 1 -ms-flex10
color 545d69 dark10
5s cubic-bezier191221-webkit-transform 5s9
-webkit-box-pack center -ms-flex-pack9
center -ms-flex-pack center9
margin-left calc -4rem9
html body content9
-ms-flex-pack center justify-content9
center justify-content center9
cubic-bezier191221-webkit-transform 5s cubic-bezier1912219
margin-right calc -4rem9
center -ms-flex-align center8
-webkit-box-align center -ms-flex-align8
0b63ce border-radius 2px8
-ms-flex-align center align-items8
5s cubic-bezier191221width 5s8
5em 1125em -5em8
media min-width 600px8
0 875em 08
0 0 875em8
center align-items center8
opacity 5s ease-in-out8
text-decoration none f-text-small-caps-span7
f-text-small-caps color 545d697
text-decoration underline f-text-small-caps7
underline f-text-small-caps color-white7
f-text-small-caps color-white ahover7
h1 f-text-small-caps-default h27
f-text-small-caps-default h2 f-text-small-caps-default7
h2 f-text-small-caps-default font-size7
f-text-small-caps-default font-size 0875rem7
f-text-small-caps-span display inline-block7
none f-text-small-caps-span display7
545d69 dark f-text-small-caps7
display inline-block f-text-small-caps-span7
inline-block f-text-small-caps-span div7
f-text-small-caps-span div display7
div display inline7
-15rem position absolute7
horizontal -webkit-box-direction normal7
font-size 0875rem line-height7
0875rem line-height 13897
-ms-flex 1 17
1 auto flex7
f-text-small-caps darkf-text-small-caps light7
light f-text-small-caps dark7
margin-left -15rem margin-right7
-15rem margin-right -15rem7
darkf-text-small-caps light darkf-text-small-caps7
dark f-text-small-caps darkf-text-small-caps7
light darkf-text-small-caps color7
darkf-text-small-caps color ffffff7
light dark f-text-small-caps7
f-text-small-caps light dark7
ffffff light f-text-small-caps7
-webkit-box-orient horizontal -webkit-box-direction7
auto flex 17
dark light f-text-small-caps7
light f-text-small-caps lightf-text-small-caps7
f-text-small-caps lightf-text-small-caps dark7
lightf-text-small-caps dark lightf-text-small-caps7
dark lightf-text-small-caps color7
lightf-text-small-caps color 545d697
color 545d69 f-text-small-caps7
545d69 f-text-small-caps color-white7
dark f-text-small-caps light7
flex 1 17
f-text-small-caps dark light7
line-height 1389 f-text-small-caps7
margin-left -1rem margin-right7
-1rem margin-right -1rem7
color 0b63ce content7
1389 f-text-small-caps color7
-webkit-box-shadow 0 07
transition transform 5s7
box-shadow 0 07
15rem f-text-content ol6
ol li f-text-content6
li f-text-content ul6
ul li position6
1rem padding-left 15rem6
li position relative6
position relative f-text-content6
relative f-text-content ol6
dark light f-single-image-decorate6
ol libefore f-text-content6
padding-left 15rem f-text-content6
0 margin-right calc6
margin-top 1rem padding-left6
light f-single-image-decorate f-single-image-wrapperbefore6
none margin-top 1rem6
list-style none margin-top6
ul list-style none6
f-text-content ul list-style6
ol f-text-content ul6
f-text-content ol f-text-content6
f-single-image-wrapperafter background-color 0b63ce6
dark f-single-image-decorate f-single-image-wrapperafter6
light f-single-image-decorate f-single-image-wrapperafter6
ease-in-out transition opacity6
ease-in-out transition transform6
3s ease-in-out transition6
libefore f-text-content ul6
display block left6
ul libefore content6
-ms-flex-direction row flex-direction6
f-single-image-wrapperbefore background-color 0b63ce6
light darkf-text-content ul6
libefore darkf-text-content ul6
normal -ms-flex-direction row6
ul libefore darkf-text-content6
-05rem dark f-single-image-decorate6
dark f-single-image-decorate f-single-image-wrapperbefore6
05em dark f-text-content6
width 05em dark6
055em width 05em6
top 055em width6
05rem top 055em6
max-width 05rem top6
row flex-direction row6
libefore content display6
05rem max-width 05rem6
max-height 05rem max-width6
05em max-height 05rem6
height 05em max-height6
2px height 05em6
border-radius 2px height6
light dark f-single-image-decorate6
05 light f-single-image-decorate6
absolute f-text-content ul6
position absolute f-text-content6
left -15rem position6
block left -15rem6
libefore background-color rgba2556
all and max-width767px6
75px media max-width6
05 light f-text-content6
li counter-increment nested-item6
text-decoration underline f-text-contentcolor-white6
f-text-contentcolor-white a color6
content counternested-item f-text-contentcolor-white6
libefore content counternested-item6
li libefore content6
ol li libefore6
nested-item f-text-content ol6
counter-increment nested-item f-text-content6
li li counter-increment6
f-text-contentcolor-white ahover text-decoration6
display flex -webkit-box-pack6
ol li li6
0b63ce f-text-content ol6
dark lightf-text-content ol6
libefore lightf-text-content ol6
ol libefore lightf-text-content6
-1rem media min-width6
0 overflow visible6
06 light f-text-content6
underline f-text-contentcolor-white ahover6
margin-right -1rem media6
255 255 066
min-width 1200px f-single-image-expand-start6
calc -4rem 75px6
155px media min-width6
-4rem 155px media6
calc -4rem 155px6
f-single-image-wrapper margin-left calc6
f-single-image-expand-start f-single-image-wrapper margin-left6
4px media min-width6
-4rem 4px media6
calc -4rem 4px6
-15rem media min-width6
position relative width6
margin-right -15rem media6
li padding-bottom 06
f-text-contentlist-spacing-none li padding-bottom6
075rem f-text-contentlist-spacing-none li6
padding-bottom 075rem f-text-contentlist-spacing-none6
li padding-bottom 075rem6
f-text-contentlist-spacing-base li padding-bottom6
none f-text-contentlist-spacing-base li6
text-decoration none f-text-contentlist-spacing-base6
255 06 light6
color 0b63ce f-text-content6
item f-text-content ol6
li libefore height6
li ul padding-left6
color rgba255 2556
0675em f-text-content ul6
top 0675em f-text-content6
-075rem top 0675em6
left -075rem top6
3px left -075rem6
height 3px left6
libefore height 3px6
ul li libefore6
padding-left 075rem f-text-content6
0b63ce f-text-content ul6
background-color 0b63ce f-text-content6
dark lightf-text-content ul6
libefore lightf-text-content ul6
ul libefore lightf-text-content6
min-width 1200px f-single-image-expand-end6
f-single-image-expand-end f-single-image-wrapper margin-left6
f-single-image-wrapper margin-left 06
margin-left 0 margin-right6
-4rem 75px media6
ul padding-left 075rem6
ul li ul6
075rem f-text-content ol6
0b63ce content counteritem6
libefore color rgba2556
light darkf-text-content ol6
overflow visible media6
libefore darkf-text-content ol6
ol libefore darkf-text-content6
600 dark f-text-content6
font-weight 600 dark6
counteritem font-weight 6006
content counteritem font-weight6
cubic-bezier191221 transition transform6
visible media min-width6
li counter-increment item6
ol li counter-increment6
counter-increment item f-text-content6
position absolute right5
transition transform 3s5
background-color fff border-radius5
f-modal modal-dialog modal-content5
padding 0 1em5
flex -webkit-box-flex 15
display flex -webkit-box-flex5
all and max-width979px5
none transform none5
cubic-bezier191221width 5s cubic-bezier191221-webkit-transform5
display flex -webkit-box-orient5
flex -webkit-box-orient vertical5
align-items center display5
25s ease-in-out transition5
-webkit-transform none transform5
html content gated-landing-page5
function var configuration5
content gated-landing-page form-wrapper5
imgstyleopacity 0 f-osb-spacer4
imggetattributesrc imgstyleopacity 04
0 f-osb-spacer height4
url imggetattributesrc imgstyleopacity4
text-decoration none f-osb-spacer4
none f-osb-spacer height4
height 0 liferay4
display none f-gartner4
f-gartner padding 2rem4
1rem col-md-5 f-gartner4
supportscssobjectfit var aspectratio4
var auivar aui4
top 0 width4
light f-logos f-logos-title4
height 2s ease-in-out4
quote-container quote-text color4
0 width 1004
0 0 1em4
width 100 z-index4
width 5s cubic-bezier191221-webkit-transform4
transform 5s cubic-bezier191221width4
opacity 2s ease-in-out4
0 padding 04
max-width 100 padding4
width 100 f-logos-logo4
5smax-width 5s cubic-bezier191221width4
flex -webkit-box-pack center4
dark f-logos f-logos-title4
comparison-table-group-label display block4
4px 50px rgba9162914
-webkit-transition opacity 5s4
0 4px 50px4
display none comparison-table-component4
position relative top4
5s ease-in-out transition4
transition opacity 5s4
content banner top4
5s ease-in-out aui4
2s ease-in-out transition4
position absolute width4
1em aui subscription-card4
rgba109117128160 5em 1125em4
aui subscription-card subscription-tag4
block height 1004
875em 0 rgba7676761604
0 aui subscription-card4
0 rgba767676160 5em4
rgba767676160 5em 1125em4
5em aui subscription-card4
1125em -5em rgba76767684
rgba1091171288 box-shadow 04
875em 0 rgba1091171281604
0 rgba109117128160 5em4
0 1em 1em4
text-align center media4
-webkit-transform 3s ease-in-out4
1125em -5em rgba10911712884
1em dark f-iconicon-type-accentafter3
aui subscription-card card-bottom-text-container3
lightf-iconicon-type-accentafter background-color 0b63ce3
darkf-iconicon-type-accentafter light darkf-iconicon-type-accentafter3
dark lightf-iconicon-type-accentafter background-color3
text-decoration none f-iconicon-type-accentafter3
lightf-iconicon-type-accentafter dark lightf-iconicon-type-accentafter3
none f-iconicon-type-accentafter background-color3
f-iconicon-type-accentafter background-color 0b63ce3
f-iconicon-type-accentafter lightf-iconicon-type-accentafter dark3
darkf-iconicon-type-accentafter background-color rgba2553
05 light f-iconicon-type-accentafter3
f-iconicon-type-accentafter darkf-iconicon-type-accentafter light3
dark f-iconicon-type-accentafter darkf-iconicon-type-accentafter3
width 1em dark3
light f-iconicon-type-accentafter dark3
light f-iconicon-type-accentafter lightf-iconicon-type-accentafter3
0b63ce border-radius 8px3
border-radius 8px content3
8px content display3
light darkf-iconicon-type-accentafter background-color3
dark light f-iconicon-type-accentafter3
f-iconicon-type-accentafter dark light3
light dark f-iconicon-type-accentafter3
height 02em width3
f-iconicon-type-accentafter light dark3
dark f-iconicon-type-accentafter light3
02em width 1em3
block height 02em3
f-logos-wrapper col-md-1 f-logos-wrapper3
aspectratiostylebackgroundimage url imggetattributesrc3
f-single-image-decorate f-single-image-wrapperafter darkf-single-image-decorate3
dark lightf-single-image-decorate f-single-image-wrapperafter3
f-single-image-wrapperafter dark lightf-single-image-decorate3
lightf-single-image-decorate f-single-image-wrapperafter dark3
f-single-image-wrapperafter lightf-single-image-decorate f-single-image-wrapperafter3
f-single-image-decorate f-single-image-wrapperafter lightf-single-image-decorate3
f-single-image-wrapperafter dark light3
f-single-image-decorate f-single-image-wrapperafter dark3
f-single-image-wrapperafter background-color rgba2553
darkf-single-image-decorate f-single-image-wrapperafter background-color3
light darkf-single-image-decorate f-single-image-wrapperafter3
f-single-image-wrapperafter light darkf-single-image-decorate3
darkf-single-image-decorate f-single-image-wrapperafter light3
f-single-image-wrapperafter darkf-single-image-decorate f-single-image-wrapperafter3
f-single-image-wrapperafter light dark3
background-color 0b63ce f-single-image-description3
f-single-image-decorate f-single-image-wrapperafter light3
margin-bottom 0 aui3
left -05rem dark3
-05rem left -05rem3
bottom -05rem left3
0b63ce bottom -05rem3
background-color 0b63ce bottom3
f-single-image-decorate f-single-image-wrapperafter background-color3
0b63ce f-single-image-decorate f-single-image-wrapperafter3
background-color 0b63ce f-single-image-decorate3
lightf-single-image-decorate f-single-image-wrapperbefore background-color3
dark lightf-single-image-decorate f-single-image-wrapperbefore3
f-single-image-wrapperbefore dark lightf-single-image-decorate3
lightf-single-image-decorate f-single-image-wrapperafter background-color3
0b63ce f-single-image-description color3
aspectratioqueryselectorimg aspectratiostylebackgroundimage url3
f-single-image-description lightf-single-image-description dark3
img aspectratioqueryselectorimg aspectratiostylebackgroundimage3
0b63ce f-icon icon-img3
var img aspectratioqueryselectorimg3
aspect-ratio-object-fit-cover var img3
fragmentelementqueryselector aspect-ratio-object-fit-cover var3
aspectratio fragmentelementqueryselector aspect-ratio-object-fit-cover3
var aspectratio fragmentelementqueryselector3
ease-in-out aui subscription-card3
545d69 function var3
color 545d69 function3
lightf-single-image-description color 545d693
dark lightf-single-image-description color3
lightf-single-image-description dark lightf-single-image-description3
light f-single-image-description lightf-single-image-description3
f-single-image-description color 545d693
dark light f-single-image-description3
f-single-image-description dark light3
light f-single-image-description dark3
ffffff light f-single-image-description3
darkf-single-image-description color ffffff3
light darkf-single-image-description color3
darkf-single-image-description light darkf-single-image-description3
f-single-image-description darkf-single-image-description light3
dark f-single-image-description darkf-single-image-description3
light dark f-single-image-description3
f-single-image-description light dark3
dark f-single-image-description light3
545d69 dark f-single-image-description3
background-color 0b63ce f-icon3
img f-icon fragments-editoreditabletypehtml3
f-icon icon-img img3
col-md-5 f-gartner col-md-43
f-gartner col-sm-4 f-gartner3
col-sm-5 f-gartner col-sm-43
f-gartner col-sm-5 f-gartner3
col-md-1 f-gartner col-sm-53
f-gartner col-md-1 f-gartner3
col-md-2 f-gartner col-md-13
f-gartner col-md-2 f-gartner3
col-md-3 f-gartner col-md-23
f-gartner col-md-3 f-gartner3
col-md-4 f-gartner col-md-33
f-gartner col-md-4 f-gartner3
transition -webkit-transform 3s3
f-gartner col-sm-3 f-gartner3
f-gartner col-sm-6 f-gartner3
col-sm-7 f-gartner col-sm-63
f-gartner col-sm-7 f-gartner3
col-sm-8 f-gartner col-sm-73
f-gartner col-sm-8 f-gartner3
col-sm-9 f-gartner col-sm-83
f-gartner col-sm-9 f-gartner3
col-sm-10 f-gartner col-sm-93
f-gartner col-sm-10 f-gartner3
col-sm-11 f-gartner col-sm-103
f-gartner col-sm-11 f-gartner3
col-sm-4 f-gartner col-sm-33
col-sm-3 f-gartner col-sm-23
col-md-7 f-gartner col-md-63
-2rem max-width 1003
f-gartner-col-2 display none3
f-gartner f-gartner-col-2 display3
f-gartner-overlay display none3
f-gartner f-gartner-overlay display3
f-gartner-description margin-top 1rem3
f-gartner f-gartner-description margin-top3
absolute transform translatey-503
position absolute transform3
05rem position absolute3
padding 05rem position3
100 padding 05rem3
margin-top -2rem max-width3
f-gartner col-sm-2 f-gartner3
block margin-top -2rem3
display block margin-top3
6px display block3
border-radius 6px display3
0d5ab8 border-radius 6px3
background-color 0d5ab8 border-radius3
f-gartner-logo background-color 0d5ab83
f-gartner f-gartner-logo background-color3
padding 2rem 1rem3
f-gartner col-sm-1 f-gartner3
col-sm-2 f-gartner col-sm-13
f-gartner col-md-6 f-gartner3
f-gartner col-md-7 f-gartner3
icon-img img f-icon3
img f-icon fragments-editoreditabletypeimage3
fragments-editoreditabletypeimage height 116em3
f-iconicon-type-large fragments-editoreditabletypeimage height3
fragments-editoreditabletypehtml f-iconicon-type-large fragments-editoreditabletypeimage3
f-iconicon-type-large fragments-editoreditabletypehtml f-iconicon-type-large3
icon-img f-iconicon-type-large fragments-editoreditabletypehtml3
f-iconicon-type-large icon-img f-iconicon-type-large3
100 f-iconicon-type-large icon-img3
height 100 f-iconicon-type-large3
svg display block3
fragments-editoreditabletypeimage svg display3
f-icon fragments-editoreditabletypeimage svg3
fragments-editoreditabletypeimage img f-icon3
116em f-iconicon-type-small icon-img3
f-icon fragments-editoreditabletypeimage img3
svg f-icon fragments-editoreditabletypeimage3
fragments-editoreditabletypehtml svg f-icon3
f-icon fragments-editoreditabletypehtml svg3
f-single-image-wrapperbefore lightf-single-image-decorate f-single-image-wrapperbefore3
fragments-editoreditabletypehtml img f-icon3
f-icon fragments-editoreditabletypehtml img3
svg f-icon fragments-editoreditabletypehtml3
icon-img svg f-icon3
f-icon icon-img svg3
img f-icon icon-img3
height 116em f-iconicon-type-small3
f-iconicon-type-small icon-img f-iconicon-type-small3
col-md-8 f-gartner col-md-73
col-sm-12 f-gartner col-123
f-gartner col-md-8 f-gartner3
col-md-9 f-gartner col-md-83
f-gartner col-md-9 f-gartner3
col-md-10 f-gartner col-md-93
f-gartner col-md-10 f-gartner3
col-md-11 f-gartner col-md-103
f-gartner f-gartner-overlay color3
ease-in-out aui subscription-cardhover3
f-gartner f-gartner-single-intensity-6 display3
f-gartner f-gartner-single-intensity-5 display3
f-gartner col-12 f-gartner3
f-gartner col-sm-12 f-gartner3
icon-img f-iconicon-type-small fragments-editoreditabletypehtml3
col-md-12 f-gartner col-sm-123
f-gartner col-md-12 f-gartner3
col-lg-12 f-gartner col-md-123
f-gartner col-lg-12 f-gartner3
opacity 1 -webkit-transition3
1 -webkit-transition opacity3
inline f-osb-spacer height3
display inline f-osb-spacer3
fragments-editoreditabletypeimage height 058em3
f-iconicon-type-small fragments-editoreditabletypeimage height3
fragments-editoreditabletypehtml f-iconicon-type-small fragments-editoreditabletypeimage3
f-iconicon-type-small fragments-editoreditabletypehtml f-iconicon-type-small3
lightf-single-image-decorate f-single-image-wrapperbefore dark3
-05rem top -05rem3
f-single-image-decorate f-single-image-wrapperbefore lightf-single-image-decorate3
html content alert-banner3
margin 0 5em3
1px solid rgba25525525513
content-wrapper display -webkit-box3
1 auto -webkit-box-orient3
auto -webkit-box-orient vertical3
content-wrapper content-block -webkit-box-flex3
content-block -webkit-box-flex 13
cta-link padding 03
padding 0 03
35s cubic-bezier1001 transition3
english united states3
border-bottom 1px solid3
digital experience platform3
f-home-banner home-banner-description max-width3
-webkit-transition -webkit-transform 3s3
top 50 transform3
f-home-banner image-section home-banner-image3
f-home-banner image-section play-button3
none media max-width3
center display flex3
modal-dialog modal-content modal-header3
var i 03
width 100 comparison-table-component3
column-reverse flex-direction column-reverse3
dark light f-logos3
display none media3
-5em rgba1091171288 box-shadow3
0 position relative3
absolute top 503
body content list-item-wrapperol-type3
body content dark-mode3
content-block padding 03
width 100 animation-card3
4s ease-in-out-webkit-transform 4s3
ease-in-out-webkit-transform 4s ease-in-out3
4s ease-in-out transition3
display none bleeding-media3
-ms-flex-direction column-reverse flex-direction3
position static -webkit-transform3
static -webkit-transform none3
transform none width3
none width 1003
width 100 bleeding-media3
relative width 1003
cubic-bezier191221width 5s cubic-bezier1912213
display flex height3
vertical -webkit-box-direction reverse3
-webkit-box-direction reverse -ms-flex-direction3
reverse -ms-flex-direction column-reverse3
light dark f-logos3
f-logos-containershow-background-color background-color f4f6f93
25s ease-in-out-webkit-transform 25s3
f-logos-wrapper col-md-8 f-logos-wrapper3
f-logos-wrapper col-sm-4 f-logos-wrapper3
col-sm-4 f-logos-wrapper col-sm-33
f-logos-wrapper col-sm-3 f-logos-wrapper3
col-sm-3 f-logos-wrapper col-sm-23
f-logos-wrapper col-sm-2 f-logos-wrapper3
col-sm-2 f-logos-wrapper col-sm-13
f-logos-wrapper col-sm-1 f-logos-wrapper3
col-sm-1 f-logos-wrapper col-md-93
f-logos-wrapper col-md-9 f-logos-wrapper3
col-md-9 f-logos-wrapper col-md-83
col-md-8 f-logos-wrapper col-md-73
f-logos-wrapper col-sm-5 f-logos-wrapper3
f-logos-wrapper col-md-7 f-logos-wrapper3
col-md-7 f-logos-wrapper col-md-63
f-logos-wrapper col-md-6 f-logos-wrapper3
col-md-6 f-logos-wrapper col-md-53
f-logos-wrapper col-md-5 f-logos-wrapper3
col-md-5 f-logos-wrapper col-md-43
f-logos-wrapper col-md-4 f-logos-wrapper3
col-md-4 f-logos-wrapper col-md-33
f-logos-wrapper col-md-3 f-logos-wrapper3
col-md-3 f-logos-wrapper col-md-23
f-logos-wrapper col-md-2 f-logos-wrapper3
col-sm-5 f-logos-wrapper col-sm-43
col-sm-6 f-logos-wrapper col-sm-53
min-width 600px col-93
col-4 f-logos-wrapper col-33
col-9 f-logos-wrapper col-83
f-logos-wrapper col-8 f-logos-wrapper3
col-8 f-logos-wrapper col-73
f-logos-wrapper col-7 f-logos-wrapper3
col-7 f-logos-wrapper col-63
f-logos-wrapper col-6 f-logos-wrapper3
col-6 f-logos-wrapper col-53
f-logos-wrapper col-5 f-logos-wrapper3
col-5 f-logos-wrapper col-43
f-logos-wrapper col-4 f-logos-wrapper3
f-logos-wrapper col-3 f-logos-wrapper3
f-logos-wrapper col-sm-6 f-logos-wrapper3
col-3 f-logos-wrapper col-23
f-logos-wrapper col-2 f-logos-wrapper3
col-2 f-logos-wrapper col-13
f-logos-wrapper col-1 f-logos-wrapper3
col-1 f-logos-wrapper col-sm-93
f-logos-wrapper col-sm-9 f-logos-wrapper3
col-sm-9 f-logos-wrapper col-sm-83
f-logos-wrapper col-sm-8 f-logos-wrapper3
col-sm-8 f-logos-wrapper col-sm-73
f-logos-wrapper col-sm-7 f-logos-wrapper3
col-sm-7 f-logos-wrapper col-sm-63
ease-in-out-webkit-transform 25s ease-in-out3
padding 5em 03
aui subscription-card subscription-item-wrapper3
f-single-image-wrapper z-index 03
height 92px position3
content height 92px3
6px content height3
border-radius 6px content3
f-single-image-wrapperafter border-radius 6px3
f-single-image-decorate f-single-image-wrapperafter border-radius3
f-single-image-wrapperbefore f-single-image-decorate f-single-image-wrapperafter3
f-single-image-decorate f-single-image-wrapperbefore f-single-image-decorate3
0 f-single-image-decorate f-single-image-wrapperbefore3
z-index 0 f-single-image-decorate3
f-single-image-decorate f-single-image-wrapper z-index3
absolute width 92px3
-35rem f-single-image-decorate f-single-image-wrapper3
margin-right -35rem f-single-image-decorate3
f-single-image-wrapper margin-right -35rem3
f-single-image-expand-endf-single-image-decorate f-single-image-wrapper margin-right3
900px f-single-image-expand-endf-single-image-decorate f-single-image-wrapper3
min-width 900px f-single-image-expand-endf-single-image-decorate3
margin-right 0 overflow3
f-single-image-expand-endf-single-image-decorate margin-right 03
1200px f-single-image-expand-endf-single-image-decorate margin-right3
min-width 1200px f-single-image-expand-endf-single-image-decorate3
f-single-image-expand-endf-single-image-decorate margin-left -1rem3
92px position absolute3
width 92px z-index3
max-width 599px f-single-image-expand-endf-single-image-decorate3
f-single-image-wrapperbefore light dark3
f-single-image-wrapperbefore dark light3
f-single-image-decorate f-single-image-wrapperbefore dark3
color fff display3
f-single-image-wrapperbefore background-color rgba2553
darkf-single-image-decorate f-single-image-wrapperbefore background-color3
light darkf-single-image-decorate f-single-image-wrapperbefore3
f-single-image-wrapperbefore light darkf-single-image-decorate3
darkf-single-image-decorate f-single-image-wrapperbefore light3
f-single-image-wrapperbefore darkf-single-image-decorate f-single-image-wrapperbefore3
f-single-image-decorate f-single-image-wrapperbefore darkf-single-image-decorate3
f-single-image-decorate f-single-image-wrapperbefore light3
92px z-index -13
-webkit-transform rotate45deg transform3
rotate45deg transform rotate45deg3
top -05rem dark3
col-md-2 f-logos-wrapper col-md-13
right -05rem top3
0b63ce right -05rem3
background-color 0b63ce right3
-webkit-transform translatey0 transform3
f-single-image-decorate f-single-image-wrapperbefore background-color3
-1 f-single-image-decorate f-single-image-wrapperbefore3
z-index -1 f-single-image-decorate3
599px f-single-image-expand-endf-single-image-decorate margin-left3
1200px f-single-image-expand-end f-single-image-wrapper3
padding 0 2em3
1200px f-single-image-expand-start margin-left3
50 position absolute3
1200px f-single-image-expand-start f-single-image-wrapper3
0 0 03
900px f-single-image-expand-start f-single-image-wrapper3
min-width 900px f-single-image-expand-start3
cta-link svg -webkit-transform3
svg -webkit-transform translatex5em3
-webkit-transform translatex5em transform3
translatex5em transform translatex5em3
f-single-image-expand-start margin-left calc3
height auto stack-animation-container3
max-width 599px f-single-image-expand-startf-single-image-decorate3
-ms-flex 1 flex3
1 flex 13
f-single-image-expand-start margin-left -15rem3
599px f-single-image-expand-start margin-left3
max-width 599px f-single-image-expand-start3
relative media max-width3
position relative media3
f-single-image-wrapper position relative3
f-single-image f-single-image-wrapper position3
training-course-agenda training-agenda-section training-agenda-item3
absolute top 03
1em text-align center3
599px f-single-image-expand-startf-single-image-decorate margin-left3
translatey0 transform translatey03
-35rem media max-width3
-ms-flex-item-align start align-self3
start align-self flex-start3
1em position relative3
900px f-single-image-expand-end f-single-image-wrapper3
min-width 900px f-single-image-expand-end3
f-single-image-expand-end margin-right calc3
1200px f-single-image-expand-end margin-right3
f-single-image-expand-end margin-left -15rem3
599px f-single-image-expand-end margin-left3
max-width 599px f-single-image-expand-end3
margin-left -35rem media3
f-single-image-expand-startf-single-image-decorate margin-left -1rem3
f-single-image-wrapper margin-left -35rem3
f-single-image-expand-startf-single-image-decorate f-single-image-wrapper margin-left3
900px f-single-image-expand-startf-single-image-decorate f-single-image-wrapper3
min-width 900px f-single-image-expand-startf-single-image-decorate3
background fff border-radius3
margin-left 0 overflow3
f-single-image-expand-startf-single-image-decorate margin-left 03
1200px f-single-image-expand-startf-single-image-decorate margin-left3
min-width 1200px f-single-image-expand-startf-single-image-decorate3
f4f6f9 border-radius 4px3
relative width calc1003
z-index 1 aui3
f-text-content ol66
f-text-content ul60
ul libefore60
ol libefore60
media min-width46
f-gartner f-gartner-overlay41
f-gartner f-gartner-col-240
display block40
position absolute37
background-color 0b63ce37
position relative36
margin-right auto34
light dark34
margin-left auto34
dark light34
aui subscription-card32
width 10032
display flex31
f-gartner f-gartner-logo27
f-gartner f-gartner-image-section27
f-gartner f-gartner-description27
display none27
0 027
color 6d758026
-webkit-box-direction normal25
text-decoration none25
dark f-text-content24
libefore light24
light f-text-content24
libefore dark24
-ms-flexbox display24
display -ms-flexbox24
-webkit-box display24
display -webkit-box24
ol li24
ahover text-decoration24
normal -ms-flex-direction24
text-decoration underline24
6d7580 text-decoration24
auto margin-right23
ease-in-out transition22
f-text-heading color-white22
rgba255 25521
255 25521
padding 021
vertical -webkit-box-direction21
-webkit-box-orient vertical21
min-width 1200px20
color 545d6920
media max-width19
flex-direction column19
transition transform19
ul li18
libefore background-color18
libefore color18
color-white ahover18
calc -4rem18
f-single-image-decorate f-single-image-wrapperbefore18
column flex-direction18
-ms-flex-direction column18
padding 1em18
f-single-image-decorate f-single-image-wrapperafter18
min-width 900px18
margin-bottom 017
margin 016
f-single-image-wrapper margin-left15
05 light15
255 0515
color fff15
max-width 599px15
text-align center15
background-color rgba25515
f-gartner f-gartner-content14
f-gartner f-gartner-single-intensity-514
5s cubic-bezier19122114
content display14
f-gartner f-gartner-single-intensity-614
dark f-text-small-caps14
col-sm-7 f-gartner14
col-sm-10 f-gartner14
light f-text-small-caps14
1 114
1 auto14
col-sm-6 f-gartner14
f-text-small-caps color-white14
col-sm-11 f-gartner14
col-sm-8 f-gartner14
col-sm-9 f-gartner14
height 013
font-weight 60013
color ffffff13
justify-content center13
color 0b63ce13
0b63ce border-radius13
absolute top13
0b63ce f-text-content12
li padding-bottom12
f-osb-spacer height12
light f-single-image-decorate12
dark f-single-image-decorate12
media max-width767px12
height 10012
darkf-text-content ul12
dark lightf-text-content12
libefore content12
libefore darkf-text-content12
light darkf-text-content12
darkf-text-content ol12
li libefore12
li counter-increment12
lightf-text-content ul12
libefore lightf-text-content12
block height12
lightf-text-content ol12
media all12
f-text-headingmargin-horizontal-auto margin-left11
underline f-text-heading11
auto f-text-headingmargin-horizontal-auto11
auto f-text-headingtext-center11
ffffff light11
f-text-headingtext-center f-text-headingtext-center-tablet-portrait-up11
f-text-headingmargin-left-auto margin-left11
auto f-text-heading11
auto f-text-headingmargin-right-auto11
f-text-headingtext-center-tablet-portrait-up margin-left11
display inline-block11
f-text-heading margin-bottom11
f-text-headingmargin-right-auto margin-right11
0 f-text-headingmargin-left-auto11
-webkit-box-sizing border-box11
col-md-5 f-gartner11
col-sm-1 f-gartner11
col-sm-2 f-gartner11
col-sm-3 f-gartner11
col-sm-4 f-gartner11
border-box box-sizing11
box-sizing border-box11
col-sm-5 f-gartner11
col-md-1 f-gartner11
col-md-2 f-gartner11
col-md-4 f-gartner11
col-md-3 f-gartner11
0 1em11
align-items center11
f-home-banner image-section10
col-md-11 f-gartner10
-ms-flex 110
col-md-10 f-gartner10
flex 110
-webkit-box-shadow 010
comparison-table-component comparison-tabledesktop-only10
545d69 dark10
function var10
col-md-6 f-gartner10
col-md-9 f-gartner10
cubic-bezier191221 transition10
text-align left10
html body10
col-md-8 f-gartner10
-webkit-box-flex 110
col-md-7 f-gartner10
1 -ms-flex10
box-shadow 010
f-logos f-logos-title10
border-radius 4px10
center justify-content9
0 overflow9
-ms-flex-pack center9
margin-left calc9
0 padding9
f-single-image-wrapperafter background-color9
body content9
center -ms-flex-pack9
-webkit-box-pack center9
margin-top 1rem9
opacity 19
cubic-bezier191221-webkit-transform 5s9
margin-left 09
5s cubic-bezier191221-webkit-transform9
margin-right calc9
z-index 19
f-single-image-wrapperbefore background-color9
overflow visible9
svg color9
img f-icon9
border-radius 6px9
overflow hidden8
visible media8
25s ease-in-out8
opacity 5s8
-webkit-box-align center8
min-width 600px8
-ms-flex-align center8
center -ms-flex-align8
0 width8
center align-items8
left 08
display inline8
3s ease-in-out8
fff border-radius8
0 rgba1091171281608
cubic-bezier191221width 5s8
5s cubic-bezier191221width8
max-width 1008
border-radius 2px8
training-course-agenda training-agenda-section8
1125em -5em8
5em 1125em8
html content8
2s ease-in-out8
875em 08
5s ease-in-out8
svg -webkit-transform8
0 875em8
margin-bottom 1em7
margin-right -1rem7
light darkf-text-small-caps7
transform none7
background-color fff7
transform translatey-507
darkf-text-small-caps color7
h2 f-text-small-caps-default7
margin-right 07
-1rem margin-right7
f-text-small-caps dark7
545d69 f-text-small-caps7
lightf-text-small-caps color7
dark lightf-text-small-caps7
f-text-small-caps lightf-text-small-caps7
height auto7
0 comparison-table-component7
horizontal -webkit-box-direction7
-webkit-box-orient horizontal7
auto flex7
visibility visible7
media max-width979px7
-15rem position7
bleeding-media bleeding-img-wrapper7
darkf-text-small-caps light7
list-style none7
f-text-small-caps light7
f-text-small-caps-span display7
border-radius 8px7
none f-text-small-caps-span7
f-modal modal-dialog7
margin-left -1rem7
transform 5s7
margin-right -15rem7
-15rem margin-right7
margin-left -15rem7
underline f-text-small-caps7
f-text-small-caps color7
inline-block f-text-small-caps-span7
lightf-text-small-caps dark7
0875rem line-height7
f-text-small-caps-default h27
h1 f-text-small-caps-default7
0b63ce content7
f-text-small-caps-default font-size7
f-text-small-caps darkf-text-small-caps7
font-size 0875rem7
div display7
line-height 13897
1389 f-text-small-caps7
f-text-small-caps-span div7
-webkit-transition opacity6
visibility hidden6
width 05em6
055em width6
aui subscription-cardhover6
max-width 05rem6
-webkit-transform 3s6
top 055em6
05rem top6
05em dark6
padding 5em6
absolute f-text-content6
05rem max-width6
liferay dxp6
ol f-text-content6
ul list-style6
none margin-top6
1rem padding-left6
padding-left 15rem6
15rem f-text-content6
dark f-logos6
li f-text-content6
li position6
relative f-text-content6
max-height 05rem6
libefore f-text-content6
ease-in-out aui6
light f-logos6
transition opacity6
block left6
left -15rem6
color 09101d6
2px height6
height 05em6
05em max-height6
-4rem 4px6
top 0675em6
f-icon fragments-editoreditabletypehtml6
darkf-single-image-decorate f-single-image-wrapperafter6
1200px f-single-image-expand-start6
dark lightf-single-image-decorate6
f-single-image-wrapperafter light6
-15rem media6
-5em rgba10911712886
f-single-image-expand-start margin-left6
padding-bottom 06
f-text-contentlist-spacing-none li6
lightf-single-image-decorate f-single-image-wrapperbefore6
f-single-image-wrapperafter dark6
075rem f-text-contentlist-spacing-none6
lightf-single-image-decorate f-single-image-wrapperafter6
flex -webkit-box-pack6
padding-bottom 075rem6
f-text-contentlist-spacing-base li6
none f-text-contentlist-spacing-base6
4px media6
f-icon icon-img6
svg f-icon6
f-icon fragments-editoreditabletypeimage6
-05rem dark6
0 margin-right6
f-single-image-expand-end f-single-image-wrapper6
1200px f-single-image-expand-end6
-1rem media6
f-single-image-wrapperbefore light6
darkf-single-image-decorate f-single-image-wrapperbefore6
fragments-editoreditabletypeimage height6
f-single-image-wrapperbefore dark6
light darkf-single-image-decorate6
cta-link color6
f-single-image-expand-startf-single-image-decorate margin-left6
75px media6
-4rem 75px6
155px media6
-4rem 155px6
f-single-image-expand-start f-single-image-wrapper6
f-text-contentcolor-white ahover6
underline f-text-contentcolor-white6
counternested-item f-text-contentcolor-white6
-075rem top6
counter-increment item6
dark f-iconicon-type-accentafter6
075rem f-text-content6
padding-left 075rem6
ul padding-left6
li ul6
0675em f-text-content6
left -075rem6
1em position6
3px left6
height 3px6
libefore height6
relative width6
flex-direction row6
row flex-direction6
-ms-flex-direction row6
dark f-single-image-description6
item f-text-content6
content counteritem6
light f-single-image-description6
z-index 06
content counternested-item6
nested-item f-text-content6
counter-increment nested-item6
li li6
top 06
06 light6
255 066
light f-iconicon-type-accentafter6
color rgba2556
background-color f4f6f96
600 dark6
counteritem font-weight6
transition -webkit-transform5
gated-landing-page quote-container5
f-logos f-logos-containershow-background-color5
-webkit-transition -webkit-transform5
100 f-logos-logo5
z-index -15
transform 3s5
absolute right5
var fragmentelement5
0 4px5
modal-dialog modal-content5
1px solid5
comparison-table-group-label display5
1em comparison-table-component5
f-gartner padding5
position static5
1em 05
gated-landing-page form-wrapper5
padding 2rem5
margin 1em5
center display5
none media5
top 505
flex -webkit-box-orient5
content gated-landing-page5
var fragmentnamespace5
flex -webkit-box-flex5
none transform5
-webkit-transform none5
border-radius 05
var configuration5
imggetattributesrc imgstyleopacity4
url imggetattributesrc4
var auivar4
1rem col-md-54
supportscssobjectfit var4
var img4
var aspectratio4
imgstyleopacity 04
0 liferay4
none f-osb-spacer4
none f-gartner4
0 f-osb-spacer4
lightf-logos f-logos-title4
auivar aui4
social-media-icons social-media-icons-container4
100 z-index4
50px rgba9162914
4px 50px4
width 5s4
opacity 2s4
0 5em4
5smax-width 5s4
100 comparison-table-component4
comparison-table-component comparison-table4
none comparison-table-component4
relative top4
1em 1em4
content height4
cta-link padding4
35s cubic-bezier10014
content alert-banner4
content banner4
banner top4
digital experience4
help you4
translatey0 transform4
svg f-home-banner4
f-home-banner f-home-banner-btn4
font-weight 4004
width 1em4
25em -25em4
none bleeding-media4
4s ease-in-out4
f-home-banner text-section4
0 rgba7676761604
color 0b5fff4
height 2s4
1em width4
quote-text color4
quote-container quote-text4
0-598-248-576-5462-2696 1773-46444
quote-containerbefore background-color4
gated-landing-pagedark-mode quote-container4
absolute width4
50 position4
gated-landing-page gated-content-media4
background-color 2a539e4
rgba767676160 5em4
100 padding4
-5em rgba76767684
width calc1004
width 504
left 504
rgba1091171288 box-shadow4
journal-content-article cardhover4
rgba109117128160 5em4
f4f6f9 border-radius4
0 position4
center media4
0 html4
content-block padding4
5em 04
top 2em4
cta-link svg4
subscription-card subscription-tag4
hidden padding4
subscription-card card-bottom-text-container4
text-transform uppercase4
f-logos-containershow-background-color background-color4
opacity 04
0 aui4
f-logos-title dark4
1em aui4
5em aui4
0 25em4
darkf-logos f-logos-title4
f-logos-title light4
0 -webkit-transition4
left -25em3
25em 5em3
f-gartner-logo background-color3
background-color 0d5ab83
1em text-align3
aspectratiostylebackgroundimage url3
f-iconicon-type-accentafter background-color3
0d5ab8 border-radius3
6px display3
aspectratioqueryselectorimg aspectratiostylebackgroundimage3
img aspectratioqueryselectorimg3
none f-iconicon-type-accentafter3
f-gartner col-md-73
8px content3
height 02em3
2rem 1rem3
02em width3
aspect-ratio-object-fit-cover var3
1em dark3
f-gartner col-sm-13
f-iconicon-type-accentafter light3
f-iconicon-type-accentafter darkf-iconicon-type-accentafter3
darkf-iconicon-type-accentafter light3
light darkf-iconicon-type-accentafter3
f-gartner col-sm-23
darkf-iconicon-type-accentafter background-color3
gated-logo-section gated-logo-section-container3
f-gartner col-sm-33
gated-logo-section gated-logo-section-title3
margin-top -2rem3
fragmentelementqueryselector aspect-ratio-object-fit-cover3
0b63ce bottom3
1 -webkit-transition3
f-single-image-wrapperafter darkf-single-image-decorate3
f-gartner-description margin-top3
left -05rem3
-05rem left3
bottom -05rem3
f-gartner-overlay display3
f-single-image-wrapperafter lightf-single-image-decorate3
0b63ce f-single-image-decorate3
f-gartner-col-2 display3
1em media3
f-single-image-wrapperbefore lightf-single-image-decorate3
stack-animation-container -webkit-box-orient3
menusetattributestyle max-height3
1 aui3
absolute transform3
05rem position3
aspectratio fragmentelementqueryselector3
f-single-image-description dark3
block margin-top3
f-iconicon-type-accentafter lightf-iconicon-type-accentafter3
545d69 function3
lightf-single-image-description color3
dark lightf-single-image-description3
lightf-single-image-description dark3
f-single-image-description lightf-single-image-description3
-2rem max-width3
0b63ce f-single-image-description3
darkf-single-image-description color3
light darkf-single-image-description3
darkf-single-image-description light3
f-single-image-description darkf-single-image-description3
f-single-image-description light3
padding 05rem3
f-single-image-description color3
f-iconicon-type-accentafter dark3
f-gartner col-sm-43
lightf-iconicon-type-accentafter dark3
f-gartner col-sm-123
f-gartner col-123
left calc503
col-sm-12 f-gartner3
f-gartner col-sm-83
white-space nowrap3
f-gartner col-sm-73
col-md-12 f-gartner3
f-gartner col-sm-93
f-gartner col-md-123
col-lg-12 f-gartner3
f-gartner col-lg-123
align-self flex-start3
f-gartner col-sm-63
inline f-osb-spacer3
col-12 f-gartner3
start align-self3
f-iconicon-type-small fragments-editoreditabletypeimage3
rotate45deg transform3
f-gartner col-md-83
f-gartner col-md-93
transform rotate45deg3
f-gartner col-md-103
f-gartner col-md-63
f-gartner-overlay color3
-webkit-transform translatey03
-ms-flex-item-align start3
f-gartner col-sm-113
-webkit-transform rotate45deg3
f-gartner-single-intensity-6 display3
transform translatey03
f-gartner-single-intensity-5 display3
margin-bottom 5em3
f-gartner col-sm-103
height 058em3
fragments-editoreditabletypehtml f-iconicon-type-small3
dark lightf-iconicon-type-accentafter3
icon-img svg3
background fff3
fragments-editoreditabletypehtml svg3
f-gartner col-md-33
fragments-editoreditabletypehtml img3
margin-bottom 2em3
f-gartner col-md-23
subscription-card subscription-item-wrapper3
fragments-editoreditabletypeimage svg3
f-gartner col-md-13
5em width3
f-gartner col-sm-53
icon-img img3
5em position3
0b63ce f-icon3
lightf-iconicon-type-accentafter background-color3
fragments-editoreditabletypeimage img3
f-gartner col-md-43
letter-spacing 1px3
border-radius 25em3
f-iconicon-type-small fragments-editoreditabletypehtml3
icon-img f-iconicon-type-small3
f-iconicon-type-small icon-img3
f-single-image-wrapperbefore darkf-single-image-decorate3
height 116em3
fff display3
border 03
svg display3
background-color 19ab4f3
f-iconicon-type-large fragments-editoreditabletypeimage3
fragments-editoreditabletypehtml f-iconicon-type-large3
f-iconicon-type-large fragments-editoreditabletypehtml3
icon-img f-iconicon-type-large3
f-iconicon-type-large icon-img3
100 f-iconicon-type-large3
116em f-iconicon-type-small3
col-7 f-logos-wrapper3
stack-animation-container animation-cardhover3
light darkf-logos3
home-banner-description max-width3
right 03
50 transform3
image-section home-banner-image3
image-section play-button3
modal-content modal-header3
modal-backdrop background-color3
background-color ffffff3
dark lightf-logos3
ffffff f-home-banner3
f-logos-title background-color3
600px col-93
col-9 f-logos-wrapper3
f-logos-wrapper col-83
col-8 f-logos-wrapper3
f-logos-wrapper col-73
col-md-1 f-logos-wrapper3
f-logos-wrapper col-md-13
f-home-banner home-banner-description3
contact us3
f-logos-wrapper col-md-23
1em simple-cardhorizontal3
svg height3
solid rgba25525525513
content-wrapper display3
auto -webkit-box-orient3
content-wrapper content-block3
content-block -webkit-box-flex3
max-width 600px3
1em sidebar-molecule3
simple-card content-wrapper3
better solutions3
cubic-bezier1001 transition3
alert-banner display3
html has-alert-container3
english united3
united states3
experience platform3
digital experiences3
b2b commerce3
cloud features3
col-md-2 f-logos-wrapper3
col-md-3 f-logos-wrapper3
comparison-table-component comparison-table-data-col3
f-logos-wrapper col-13
f-logos-wrapper col-sm-63
col-sm-7 f-logos-wrapper3
f-logos-wrapper col-sm-73
col-sm-8 f-logos-wrapper3
f-logos-wrapper col-sm-83
col-sm-9 f-logos-wrapper3
f-logos-wrapper col-sm-93
col-1 f-logos-wrapper3
col-2 f-logos-wrapper3
f-logos-wrapper col-sm-53
f-logos-wrapper col-23
col-3 f-logos-wrapper3
f-logos-wrapper col-33
col-4 f-logos-wrapper3
f-logos-wrapper col-43
col-5 f-logos-wrapper3
f-logos-wrapper col-53
col-6 f-logos-wrapper3
col-sm-6 f-logos-wrapper3
col-sm-5 f-logos-wrapper3
f-logos-wrapper col-md-33
col-md-8 f-logos-wrapper3
col-md-4 f-logos-wrapper3
f-logos-wrapper col-md-43
col-md-5 f-logos-wrapper3
f-logos-wrapper col-md-53
col-md-6 f-logos-wrapper3
f-logos-wrapper col-md-63
col-md-7 f-logos-wrapper3
f-logos-wrapper col-md-73
f-logos-wrapper col-md-83
f-logos-wrapper col-sm-43
col-md-9 f-logos-wrapper3
f-logos-wrapper col-md-93
col-sm-1 f-logos-wrapper3
f-logos-wrapper col-sm-13
col-sm-2 f-logos-wrapper3
f-logos-wrapper col-sm-23
col-sm-3 f-logos-wrapper3
f-logos-wrapper col-sm-33
col-sm-4 f-logos-wrapper3
comparison-table-component comparison-table-has-feature3
comparison-table-row-label display3
-webkit-transform translatex5em3
padding-left 03
900px f-single-image-expand-endf-single-image-decorate3
f-single-image-expand-endf-single-image-decorate margin-right3
1200px f-single-image-expand-endf-single-image-decorate3
f-single-image-expand-endf-single-image-decorate margin-left3
599px f-single-image-expand-endf-single-image-decorate3
training-agenda-section training-agenda-item3
2em position3
900px f-single-image-expand-end3
f-single-image-expand-end margin-right3
f-single-image-wrapper margin-right3
margin auto3
f-single-image-expand-end margin-left3
599px f-single-image-expand-end3
-35rem media3
margin-left -35rem3
f-single-image-expand-startf-single-image-decorate f-single-image-wrapper3
900px f-single-image-expand-startf-single-image-decorate3
0 2em3
f-single-image-expand-endf-single-image-decorate f-single-image-wrapper3
margin-right -35rem3
course-features-wrapper feature-group3
width 92px3
translatex5em transform3
top -05rem3
-05rem top3
right -05rem3
0b63ce right3
transform translatex5em3
-1 f-single-image-decorate3
92px z-index3
92px position3
-35rem f-single-image-decorate3
height 92px3
6px content3
f-single-image-wrapperafter border-radius3
auto stack-animation-container3
f-single-image-wrapperbefore f-single-image-decorate3
1 flex3
0 f-single-image-decorate3
f-single-image-wrapper z-index3
f-logos-wrapper col-63
1200px f-single-image-expand-startf-single-image-decorate3
padding-bottom 5em3
border-bottom 1px3
flex height3
ease-in-out-webkit-transform 4s3
static -webkit-transform3
none width3
100 bleeding-media3
bleeding-media bleeding-media-container3
bleeding-media bleeding-media-containerhover3
ease-in-out visibility3
bleeding-media-container enlarge-button3
bleeding-media-video display3
100 animation-card3
-webkit-box-direction reverse3
reverse -ms-flex-direction3
-ms-flex-direction column-reverse3
column-reverse flex-direction3
flex-direction column-reverse3
bleeding-media-img display3
calc100vw 3em3
comparison-table-row border-top3
comparison-table-rowlast-child border-bottom3
4s ease-in-out-webkit-transform3
animation-card content-block3
599px f-single-image-expand-startf-single-image-decorate3
background-size cover3
content-wrapper width3
training-banner training-course-banner-link-container3
-webkit-transform translatex-503
transform translatex-503
900px f-single-image-expand-start3
training-video-collection column-featured3
25s ease-in-out-webkit-transform3
ease-in-out-webkit-transform 25s3
599px f-single-image-expand-start3
3s transition3
relative media3
f-single-image-wrapper position3
f-single-image f-single-image-wrapper3
5s transition3
padding-bottom 1em3
content list-item-wrapperol-type3
list-item-wrapperol-type list-itembefore3
content dark-mode3
accordion-generic-container accordion-header3
f-single-image-decorate f-single-image-wrapper3
f-gartner287
0236
display167
dark136
light136
libefore132
color132
f-text-content126
auto106
media98
background-color95
ol90
ul90
width89
f-logos-wrapper85
height81
margin-left80
position80
none78
margin-right76
center74
1em71
padding67
f-logos-logo65
162
li60
transform59
content59
left54
top54
253
comparison-table-component52
text-decoration51
min-width51
max-width51
0b63ce50
border-radius50
f-text-small-caps49
f-logos-title48
var45
transition45
5s45
aui43
f-gartner-overlay42
flex42
svg42
342
5em40
block40
f-gartner-col-240
-webkit-transform39
f-single-image-decorate39
ease-in-out39
absolute37
column37
margin-bottom37
relative36
color-white36
subscription-card36
f-home-banner35
f-text-heading33
margin31
flex-direction31
f-single-image-wrapperafter30
f-single-image-wrapperbefore30
opacity30
background29
html29
-webkit-box-direction29
-webkit-box-orient29
-ms-flex-direction28
f-gartner-description27
fff27
f-gartner-image-section27
padding-bottom27
normal27
f-gartner-logo27
6d758026
ahover26
bleeding-media26
text-align25
padding-left25
f-single-image-wrapper24
-webkit-box24
-ms-flexbox24
lightf-text-content24
underline24
darkf-text-content24
max-height24
25em24
-webkit-transition23
z-index22
2em22
liferay22
1200px22
border-box22
vertical21
-15rem21
rgba25521
4px21
margin-top21
col-sm-620
font-weight20
col-sm-820
function20
420
545d6920
col-sm-720
col-sm-920
overflow19
900px19
-4rem19
gated-landing-page19
max-width767px18
justify-content18
calc18
f-icon18
ffffff18
col-sm-417
col-sm-217
col-md-517
your17
col-md-417
col-md-317
animation-card17
cta-link17
col-md-217
col-sm-317
col-sm-117
col-md-117
col-sm-517
all17
hidden17
font-size17
col-md-716
col-md-816
3s16
col-md-616
25s16
8px16
f-logos16
visible16
col-md-916
f-single-image-description15
0515
img15
f-iconicon-type-accentafter15
599px15
05rem15
f-gartner-single-intensity-514
stack-animation-container14
-ms-flex-pack14
f-gartner-single-intensity-614
col-sm-1114
lightf-text-small-caps14
f-gartner-content14
f-text-small-caps-span14
col-sm-1014
darkf-text-small-caps14
cubic-bezier19122114
row14
1rem14
platform14
f-text-small-caps-default14
-1rem14
-webkit-box-pack13
visibility13
513
align-items13
content-block13
digital13
counter-increment13
max-width979px12
075rem12
f-single-image-expand-start12
content-wrapper12
body12
f-single-image-expand-end12
f-text-contentcolor-white12
sidebar-molecule12
box-shadow12
icon-img12
darkf-single-image-decorate12
-webkit-box-shadow12
training-course-agenda12
15em12
fragments-editoreditabletypeimage12
if12
05em12
fragments-editoreditabletypehtml12
f-osb-spacer12
-05rem12
lightf-single-image-decorate12
inline-block11
f-text-headingmargin-left-auto11
f-text-headingmargin-horizontal-auto11
padding-right11
f-text-headingmargin-right-auto11
-webkit-box-sizing11
f-text-headingtext-center11
line-height11
f-text-headingtext-center-tablet-portrait-up11
experiences11
right11
fill11
-webkit-box-flex11
-ms-flex11
-25em11
box-sizing11
600px11
col-md-1010
3em10
experience10
col-md-1110
dxp10
quote-container10
-ms-flex-align10
image-section10
-5em10
-webkit-box-align10
15rem10
f-logos-containershow-background-color10
comparison-tabledesktop-only10
training-video-collection10
6px9
training-agenda-section9
padding-top9
f-iconicon-type-small9
start9
f-iconicon-type-large9
calc1009
gated-logo-section9
cubic-bezier191221-webkit-transform9
f-single-image-expand-startf-single-image-decorate9
translatey-509
f-single-image-expand-endf-single-image-decorate9
profile-card9
enlarge-button9
4s9
solutions9
1px9
new8
ease-in-out-webkit-transform8
training-componentscheme-card8
div8
customers8
f-modal8
bottom8
us8
f4f6f98
rgba1091171281608
features8
cubic-bezier191221width8
rgba10911712888
h28
2px8
1125em8
875em8
accordion-generic-container8
translatey08
2s8
inline8
journal-content-article8
0b5fff7
horizontal7
align-self7
customer7
course-features-wrapper7
ie7
h17
-ms-flex-item-align7
min-height7
course-info-wrapper7
67
0875rem7
b2b7
modal-dialog7
comparison-table-group-label7
you7
list-style7
bleeding-media-container7
quote-wrapper7
commerce7
bleeding-img-wrapper7
col-96
systems6
2rem6
col-16
col-46
col-36
darkf-logos6
col-86
lightf-logos6
col-56
col-66
col-76
col-26
-35rem6
translatex5em6
training-banner6
counternested-item6
f-text-contentlist-spacing-none6
icon-wrapper6
50px6
76
translatex-506
155px6
75px6
066
video-card6
92px6
darkf-single-image-description6
lightf-single-image-description6
lightf-iconicon-type-accentafter6
gated-landing-pagedark-mode6
2a539e6
nested-item6
f-text-contentlist-spacing-base6
counteritem6
055em6
09101d6
social-media-icons6
subscription-cardhover6
card-bottom-text-container6
0d5ab86
item6
rotate45deg6
darkf-iconicon-type-accentafter6
column-reverse6
bleeding-mediableeding-media-enlarge-img6
0675em6
-075rem6
3px6
flex-start6
fragmentelement5
fragmentnamespace5
white-space5
text-transform5
nowrap5
subscription-popup5
form-wrapper5
services5
dark-mode5
modal-content5
contact5
configuration5
35s5
we5
85
alert-banner5
social-media-iconslight5
partners5
social-media-iconsdark5
comparison-table-row-label5
english5
solid5
comparison-table5
static5
list-itembefore5
video5
cloud5
16px5
self-service5
aspectratio5
play-button5
text-section4
supportscssobjectfit4
true4
auivar4
url4
imggetattributesrc4
imgstyleopacity4
portlet4
home-banner-image4
bleeding-media-img4
cardhover4
info-group4
list-item-wrapper4
list-item-wrapperol-type4
accordion-header4
justify4
accordion-generic-containeropen4
animation-cardanimation-card-dark-mode4
bleeding-media-video4
5smax-width4
rgba76767684
border-bottom4
comparison-table-data-col4
15s4
simple-cardhorizontal4
simple-card4
svgsocial-media-iconsdark4
svgsocial-media-iconslight4
social-media-icons-container4
cubic-bezier10014
40px4
rgba7676761604
banner4
rgba9162914
card-initial-text4
subscription-tag4
letter-spacing4
75em4
uppercase4
94
modal-header4
border4
30px4
gated-content-media4
5px4
quote-containerbefore4
0-598-248-576-5462-26964
1773-46444
104
114
124
134
quote-text4
stack-animation-containerhover4
animation-cardhover4
144
bleeding-media-text4
united4
best4
f-home-banner-btn4
business4
help4
latest4
create4
revenue4
enterprise4
into4
one4
modern3
-9px3
-3em3
8em3
gated-logo-section-container3
153
gated-logo-section-title3
wrapper3
open3
02em3
gated-content-mediabefore3
10px3
rgba25525525553
our3
modal-backdrop3
aspectratiostylebackgroundimage3
aspectratioqueryselectorimg3
aspect-ratio-object-fit-cover3
fragmentelementqueryselector3
community3
modalcontent3
modalinnerhtml3
success3
connect3
better3
116em3
way3
058em3
subscription-tool-tip-triangle3
35rem3
swiftypesearchinitialized3
subscription-item-wrapper3
menusetattributestyle3
has-alert-container3
-2rem3
19ab4f3
close3
press3
company3
calc503
175em3
across3
management3
end3
subscription-popupmodal3
challenges3
build3
col-123
col-sm-123
col-md-123
col-lg-123
have3
163
cookievalue3
const3
55acee3
comparison-tablesubscription-col-23
home-banner-description3
reverse3
blog3
bleeding-mediableeding-media-enlarge-video3
calc100vw3
comparison-table-group3
comparison-table-row3
border-top3
comparison-table-rowlast-child3
24px3
e-book3
bleeding-media-containerhover3
comparison-table-groupfirst-child3
comparison-table-has-feature3
rgba25525525513
media-card3
scheme-card3
173
featured3
single3
analytics3
3b59983
0077b53
product3
f-logos-container3
training-agenda-item3
background-size3
insurance3
11px3
functionevent3
states3
feature-group3
28px3
48px3
complex3
training-course-banner-link-container3
column-featured3
partner3
cover3
title3
f-single-image3
faster3
span3
work3
employees3
list-item3
accordion-content3
equip3
costs3
support3
gartner3
value3

Who hosts Liferay.net?

Liferay.net Hosting Provider Information

Hosted IP Address:173.196.212.15
Hosted Hostname:rrcs-173-196-212-15.west.biz.rr.com
Service Provider:TWC-20001-PACWEST
Hosted Country:United StatesUS
Location Latitude:33.9883
Location Longitude:-118.3294
Webserver Software:CloudFlare

Is "TWC-20001-PACWEST" in the Top 10 Hosting Companies?

Name
Percentage
GOOGLE
17.2088%
Unknown
5.0138%
AS-26496-GO-DADDY-COM-LLC
4.3256%
NAMECHEAP-NET
3.6268%
AMAZON-AES
2.7254%
GoDaddy.com, LLC
2.4825%
UNIFIEDLAYER-AS-1
2.3319%
Fara Negar Pardaz Khuzestan
1.9947%
CONFLUENCE-NETWORK-INC
1.7092%
1&1 Internet AG
1.6708%
TWC-20001-PACWEST
0.0005%

HTTP Header Analysis for Liferay.net

Http-Version: 1.1
Status-Code: 200
Status: 200
Date: Wed, 02 Jun 2021 02:03:14 GMT
Content-Type: text/html;charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Vary: Accept-Encoding
x-content-type-options: nosniff
x-frame-options: SAMEORIGIN
x-xss-protection: 1
expires: Thu, 01 Jan 1970 00:00:00 GMT
cache-control: private, no-cache, no-store, must-revalidate
pragma: no-cache
Via: 1.1 google
CF-Cache-Status: DYNAMIC
cf-request-id: 0a6c0efa740000dbd38c2c5000000001
Expect-CT: max-age=604800, report-uri="https://report-uri.cloudflare.com/cdn-cgi/beacon/expect-ct"
Strict-Transport-Security: max-age=2592000; includeSubDomains
Server: cloudflare
CF-RAY: 658d1aa3e9cfdbd3-LHR
Content-Encoding: gzip

Liferay.net Domain Nameserver Information

HostIP AddressCountry
jim.ns.cloudflare.com 173.245.59.125
sofia.ns.cloudflare.com 108.162.192.223


Need to find out who hosts Liferay.net?


Domain Registration (WhoIs) information for Liferay.net

 Domain Name: LIFERAY.NET
Registry Domain ID: 22682052_DOMAIN_NET-VRSN
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.godaddy.com
Updated Date: 2021-03-18T05:30:17Z
Creation Date: 2000-03-17T19:30:39Z
Registrar Registration Expiration Date: 2022-03-17T18:30:39Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.4806242505
Domain Status: clientTransferProhibited http://www.icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited http://www.icann.org/epp#clientUpdateProhibited
Domain Status: clientRenewProhibited http://www.icann.org/epp#clientRenewProhibited
Domain Status: clientDeleteProhibited http://www.icann.org/epp#clientDeleteProhibited
Registrant Organization:
Registrant State/Province: California
Registrant Country: US
Registrant Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=LIFERAY.NET
Tech Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=LIFERAY.NET
Admin Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=LIFERAY.NET
Name Server: JIM.NS.CLOUDFLARE.COM
Name Server: SOFIA.NS.CLOUDFLARE.COM
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2021-06-02T02:03:20Z

Websites with Similar Names

Lifer.cc
Прогнозы и ставки на спорт бесплатно | Bewinto.com
Lifer.info
lifer.info is available for purchase - Sedo.com
Lifer.tw
送行者的酸甜苦辣 :: 痞客邦 ::
Lifer3.top
{{SiteName}}
Lifer962231.shop
lifer962231.shop
Lifera.shop
Lifera – Salud y Bienestar

Recently Updated Websites

Proautopix.com (5 seconds ago.)Kogan.com.au (11 seconds ago.)Pilawmastery.org (12 seconds ago.)Rumfa.ng (13 seconds ago.)Eny-it.com (13 seconds ago.)Skifie.com (15 seconds ago.)Endunevenhandedpolicing.com (17 seconds ago.)Parkauto96.ru (17 seconds ago.)Raptorsupplyllc.com (19 seconds ago.)Hbcwz.com (21 seconds ago.)Heartandhome.net (24 seconds ago.)Loyalty-union.com (29 seconds ago.)Charliebrowngonewild.com (29 seconds ago.)Spbzvuk.ru (35 seconds ago.)Whatcrmshouldiuse.com (38 seconds ago.)Minecraft123.com (39 seconds ago.)Zihuaquan.com (39 seconds ago.)Bergfrieden-kgv.de (40 seconds ago.)Dazzleartist.com (44 seconds ago.)Betnano.vip (45 seconds ago.)Merchpass.life (46 seconds ago.)Active-hoken.com (48 seconds ago.)Sunlightallnight.com (49 seconds ago.)Hzsfcyy.com (51 seconds ago.)Fazendofortuna.com (55 seconds ago.)Elitehsolutions.com (1 minute ago.)Davis-paving.com (1 minute 1 second ago.)Prepaidcardtermsandconditions.com (1 minute 2 seconds ago.)Guyawenhua.com (1 minute 3 seconds ago.)Wildblueofestero.com (1 minute 6 seconds ago.)

Recently Searched Keywords

bendix (1 second ago.)broadband (2 seconds ago.)vestibulum (6 seconds ago.)建设银行个人网上银行 (6 seconds ago.)kadıköy escort (7 seconds ago.)tk xxx (9 seconds ago.)style-jr7ujvkflabel (10 seconds ago.)wanneer krijg (11 seconds ago.)michael ernst ruge (18 seconds ago.)jesus and barabbas there is a little-known but very intriguing coincidence in this story. or was it a coincidence (18 seconds ago.)margin 0 auto (18 seconds ago.)ruge charities (19 seconds ago.)30 2020 (21 seconds ago.)livetitle name viewer (24 seconds ago.)verwerking van (24 seconds ago.)use-iconfill00b4b3sqs-slide-wrapperdata-slide-typecover-page (25 seconds ago.)augustinian values (25 seconds ago.)src urlstaticparastoragecomservicesthird-partyfontsuser-site-fontsfontsopen-sourceopensans-italic-webfonteot src (32 seconds ago.)all and max-width600pxsqs-slide-wrapperdata-slide-typecover-page (34 seconds ago.)fiire.org.in (35 seconds ago.)add your listing (39 seconds ago.)fiire.org.in (40 seconds ago.)shaved (44 seconds ago.)crediti (46 seconds ago.)form-wrapper (49 seconds ago.)30 pussy (56 seconds ago.)je inschrijving (57 seconds ago.)four-18 (58 seconds ago.)hyderabad indian (1 minute 8 seconds ago.)scaune de birou (1 minute 8 seconds ago.)