Favicon Website Thumbnail
Curtains | Ready Made Curtains | Net Curtains | Duvet Covers | Duvet Set | Bed Linen
Low trust score
Add a review Change category Claim this site
We are part of Factory Direct Textiles: a family run business in Co. Durham UK selling Curtains, Ready Made Curtains, Net Curtains, Duvet Covers, Duvet Set and Bed Linen

Domain summary

Domain label
Domain extension
Domain registered:
Domain updated:
Global Traffic Rank
Statvoo Rating
Trust Score
Low Trust Score
Estimated worth
Estimated daily income
Estimated monthly income

Rank summary

How is ranked relative to other sites:

Percentage of visits to from a search engine:

Frequently Asked Questions (FAQ)

Q: When was registered?
A: was registered 14 years, 1 month, 2 weeks, 5 days, 11 hours, 53 minutes, 3 seconds ago on Thursday, August 10, 2006.
Q: When was the WHOIS for last updated?
A: The WHOIS entry was last updated 2 months, 3 weeks, 2 days, 11 hours, 53 minutes, 3 seconds ago on Monday, July 6, 2020.
Q: What are's nameservers?
A: DNS for is provided by the following nameservers:
Q: Who is the registrar for the domain?
A: The domain has been registered at Nominet UK.
Q: What is the traffic rank for
A: has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit each day?
A: receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does resolve to?
A: resolves to the IPv4 address
Q: In what country are servers located in?
A: has servers located in the United Kingdom.
Q: What webserver software does use?
A: is powered by Microsoft-IIS/8.5 webserver.
Q: Who hosts
A: is hosted by Peer 1 Network (USA) Inc. in England, Portsmouth, United Kingdom, Po5.
Q: How much is worth?
A: has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Who hosts Hosting Provider Information

Hosted IP Address:
Hosted Hostname:
Service Provider:Peer 1 Network (USA) Inc.
Hosted Country:United KingdomGB
Location Latitude:50.7967
Location Longitude:-1.0833
Webserver Software:Microsoft-IIS/8.5

Is "Peer 1 Network (USA) Inc." in the Top 10 Hosting Companies?


HTTP Header Analysis for

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Cache-Control: private
Content-Type: text/html
Server: Microsoft-IIS/8.5
X-Powered-By: ASP.NET
Date: Fri, 28 Aug 2020 19:40:25 GMT
Content-Length: 56453 Domain Nameserver Information

HostIP AddressCountry

Need to find out who hosts

WhoIs information for

 Domain name:

Data validation:
Nominet was able to match the registrant's name and address against a 3rd party data source on 04-Jul-2016

123-Reg Limited t/a 123-reg [Tag = 123-REG]

Relevant dates:
Registered on: 10-Aug-2006
Expiry date: 10-Aug-2022
Last updated: 06-Jul-2020

Registration status:
Registered until expiry date.

Name servers:

WHOIS lookup made at 21:06:17 14-Jul-2020

This WHOIS information is provided for free by Nominet UK the central registry
for .uk domain names. This information and the .uk WHOIS are:

Copyright Nominet UK 1996 - 2020.

You may not access the .uk WHOIS or use any data from it except as permitted
by the terms of use available in full at,
which includes restrictions on: (A) use of the data for advertising, or its
repackaging, recompilation, redistribution or reuse (B) obscuring, removing
or hiding any or all of this notice and (C) exceeding query rate or volume
limits. The data is provided on an 'as-is' basis and may lag behind the
register. Access may be withdrawn or restricted at any time. Free SEO Report

Website Inpage Analysis for

H1 Headings

1 :
  1. We are one of 's leading retailer of Curtains, Bed Linen, Blinds and Accessories

H2 Headings

3 :
  1. Wake up to Beautiful Bed Linen
  2. Brighten up your home with new curtains
  3. Stunning ready-made curtain just in stock!

H3 Headings

0 :

H4 Headings

42 :
  1. Angus Navy Check Brushed Cotton Duvet Set
  2. Ashford Natural Pencil Pleat Curtains
  3. Ashford Silver Pencil Pleat Curtains
  4. balmoral check natural eyelet curtains
  5. Burford Red & Gold Pencil Pleat curtains
  6. Carrington Eyelet Cleance Curtains
  7. Colette 200 thread count Bedding Range
  8. Divine Unicorns Bedding Range
  9. Enchanted Forest Charcoal Eyelet Curtains
  10. Enchanted Forest SilverEyelet Curtains
  11. Grey venetian pvc blinds
  12. Hanworth Pink Duvet Set
  13. Bondi Grey Eyelet Curtains
  14. Charity Eyelet Curtains
  15. Halo Blush Pink Blockout Eyelet Curtains
  16. Paige Blush Ready Made Eyelet Curtains
  17. Paige Ochre Ready Made Eyelet Curtains
  18. arden chintz pencil pleat luxury ready made curtains
  19. Arden Silver Pencil Pleat Luxury Ready Made Curtains
  20. Harrogate White Lined Voile Curtains
  21. PVC Venetian Blinds white extra long drop
  22. Ravali Ivory Cream pencil pleat curtains
  23. arizona ring top ready made eyelet curtains
  24. balmoral check teal eyelet curtains
  25. belgravia chocolate pencil pleat curtains
  26. blockout savoy light reducing curtains
  27. Cassa Natural Eyelet Ready Made Curtains
  28. Delilah Ready made curtains
  29. designer eyelet curtains coco ivory
  30. devon ready made curtains
  31. edinburgh pencil pleat self lined light reducing curtains
  32. Fairburn Stripe Blue duvet set
  33. faux silk black plain curtains
  34. faux silk cream pencil pleat curtains
  35. Eyelet Curtains
  36. Pencil Pleat Curtains
  37. Duvets Sets
  38. Venetian Blinds
  39. From the Frontline
  40. Tell your Friends
  41. A Helping Hand
  42. Customer Feedback

H5 Headings

4 :
  1. And we love talking linen, so call us on 01207 509 911 or find out more about us
  2. Lighter Mornings and Lighter Nights
  3. Sign up for exclusive offers
  4. Like our Facebook Page

H6 Headings

0 :


2 :

Total Images

74 :

Google Adsense

Not Applicable

Google Analytics


Links - Internal

  1. No text
  2. View Cart
  3. Blog
  4. Delivery Info
  5. Login
  6. Contact
  7. No text
  8. £0.00
  9. Home
  10. Customer Info
  11. › View Cart
  12. › Blog
  13. › Delivery Info
  14. › Login
  15. › Contact
  16. Curtains
  17. › Pencil Pleat Curtains
  18. › Eyelet Curtains
  19. › Longer Length Curtains
  20. › Kitchen Curtains
  21. › Lined Voile Curtains
  22. › Voile Panels
  23. › Net Curtains
  24. › Blackout Curtains
  25. Bedding
  26. › Quilts and Pillows
  27. › Duvet Sets
  28. › Duvet Sets & Curtains
  29. › Super King Size Bedding
  30. › Designer Bed Linen
  31. › Sheets
  32. › 4 Foot Bedding
  33. › Mattress Protectors
  34. › Throws
  35. › Nursery Bedding
  36. › Kids Bedding
  37. Blinds
  38. › Venetian Blinds
  39. › Roller Blinds
  40. › Blackout Blinds
  41. Accessories
  42. › Tie Backs
  43. › Pelmets
  44. › Cushion Covers
  45. › Tableware
  46. › Bathroom Accessories
  47. › Curtain Poles and Tracks
  48. › Home Accessories
  49. Curtain Poles & Tracks
  50. Special Offers
  51. Clearance
  52. View Products
  53. View Products
  54. View Products
  55. about us
  56. No text
  57. Angus Navy Check Brushed Cotton Duvet Set
  58. No text
  59. Ashford Natural Pencil Pleat Curtains
  60. No text
  61. Ashford Silver Pencil Pleat Curtains
  62. No text
  63. balmoral check natural eyelet curtains
  64. No text
  65. Burford Red & Gold Pencil Pleat curtains
  66. No text
  67. Carrington Eyelet Cleance Curtains
  68. No text
  69. Colette 200 thread count Bedding Range
  70. No text
  71. Divine Unicorns Bedding Range
  72. No text
  73. Enchanted Forest Charcoal Eyelet Curtains
  74. No text
  75. Enchanted Forest SilverEyelet Curtains
  76. No text
  77. Grey venetian pvc blinds
  78. No text
  79. Hanworth Pink Duvet Set
  80. No text
  81. Bondi Grey Eyelet Curtains
  82. No text
  83. Charity Eyelet Curtains
  84. No text
  85. Halo Blush Pink Blockout Eyelet Curtains
  86. No text
  87. Paige Blush Ready Made Eyelet Curtains
  88. No text
  89. Paige Ochre Ready Made Eyelet Curtains
  90. No text
  91. arden chintz pencil pleat luxury ready made curtains
  92. No text
  93. Arden Silver Pencil Pleat Luxury Ready Made Curtains
  94. No text
  95. Harrogate White Lined Voile Curtains
  96. No text
  97. PVC Venetian Blinds white extra long drop
  98. No text
  99. Ravali Ivory Cream pencil pleat curtains
  100. No text
  101. arizona ring top ready made eyelet curtains
  102. No text
  103. balmoral check teal eyelet curtains
  104. No text
  105. belgravia chocolate pencil pleat curtains
  106. No text
  107. blockout savoy light reducing curtains
  108. No text
  109. Cassa Natural Eyelet Ready Made Curtains
  110. No text
  111. Delilah Ready made curtains
  112. No text
  113. designer eyelet curtains coco ivory
  114. No text
  115. devon ready made curtains
  116. No text
  117. edinburgh pencil pleat self lined light reducing curtains
  118. No text
  119. Fairburn Stripe Blue duvet set
  120. No text
  121. faux silk black plain curtains
  122. No text
  123. faux silk cream pencil pleat curtains
  124. No text
  125. No text
  126. No text
  127. No text
  128. Lighter Mornings and Lighter Nights
  129. › Read Full Article
  130. › Measuring for Curtains
  131. › Measuring for Blinds
  132. › Choosing Colours
  133. View All »
  134. About us
  135. Contact us
  136. Visit our shop
  137. Our Blog
  138. Customer Services
  139. Delivery
  140. Your Questions
  141. Customer Feedback
  142. Terms of Business
  143. Our Guarantee
  144. privacy policy
  145. terms and conditions

Links - Internal (nofollow)


Links - Outbound

  1. Tweet
  3. Edward Robertson web design
  4. Responsive Grid System

Links - Outbound (nofollow)


Keyword Cloud for

contactblackwindowiffusioncurtainduvet setlight reducingpencil pleat curtainsbed linenluxuryseesilkrange of readyallpleatardenpound499outleafeyelettabusreducingcount percalekingmade eyeletredsilver pencilvarbedding rsaquochintz pencilduvet setsscriptcharcoalblogcurtainsblackoutcontact useggcurtains was pound1499nowtopbluecurtainspound399pinkbrushednaturalpleat curtainsfittedochrecurtains rsaquosizehomersaquoswarmeyeletfifeviewgreenreadynatural eyeletvenetianeyelet curtainsournavycottonupsilverblackoutsee ourplainsuperbeddingblushcoverlined voilepound1199blinds rsaquoringthreadblockoutpound1499nowfauxready madensetsfaux silkbedbellewhitepercaleivorylacepvcduckegg pencilfloralcreameyelet curtainsvelvawoodgrainpanelvenetian blindscheckpound499nowring topcurtainsravalicurtainsvelvajustblindslinedcotton duvetvoiletieaccessoriescurtains from pound599pleatmadepound599stripecurtains from pound499setcontentcurtainseyeletcurtainslineddeliverylinenready made curtainsamponepencil pleatardencustomer0stripe fusionactiveducklightthread countready made eyeletpencilmade eyelet curtainsinfoproductsyourgreyduckeggwecurtainsreadysparklerangecountthread count percaleking sizeduvetlesschintzvelveteyeletwhitworthpencil pleat4 lessmade curtains

Longtail Keyword Density for

pencil pleat curtains8
thread count percale7
ready made curtains6
ready made eyelet4
made eyelet curtains4
range of ready3
curtains from pound5993
curtains from pound4993
curtains was pound1499now3
pencil pleat16
eyelet curtains14
ready made13
pleat curtains11
thread count11
curtains rsaquo9
faux silk9
count percale7
made curtains6
eyelet curtainsvelva6
venetian blinds5
ring top5
made eyelet5
duvet set5
king size5
bedding rsaquo4
blinds rsaquo4
stripe fusion4
lined voile4
duckegg pencil3
pencil pleatarden3
4 less3
contact us3
chintz pencil3
light reducing3
duvet sets3
see our3
natural eyelet3
silver pencil3
bed linen3
cotton duvet3
panel3 Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if is a scam?

Websites with Similar Names
Suncoast Sea Glass - Silver & Sea Glass Jewelry
The Linen Basket
Fine Linens, Bed, Bath, Table - Linen Boutique
Motel Owners! Top Quality Commercial Bed and Bath Linen at Low Prices: – Linen Direct
Linen Direct Limited
Linen-fashion - Ekskluzywna pościel oraz obrusy
Top Luxury Interior Designers in Delhi |Dream Home Interior decorators|Home Interior decorators in Delhi
Linen Press | Fine writing for women, by women

Recently Updated Websites 3 seconds 3 seconds 4 seconds 4 seconds 4 seconds 4 seconds 5 seconds 5 seconds 5 seconds 5 seconds 6 seconds 6 seconds 6 seconds 6 seconds 6 seconds 7 seconds 7 seconds 7 seconds 8 seconds 8 seconds 8 seconds 8 seconds 11 seconds 11 seconds 11 seconds 11 seconds 12 seconds 13 seconds 13 seconds 13 seconds ago.