Cloud Hosting & Linux Servers | Linode

Safety: High trust score
Year Founded: 2003
Global Traffic Rank: 4,672
Estimated Worth: $3,080,160
Last updated:2020-11-05

Simplify your cloud infrastructure with Linode's robust set of tools to develop, deploy, and scale your applications faster and easier.

Domain summary

Domain label
Domain extension
Domain registered:
Domain updated:
Global Traffic Rank
Statvoo Rating
Trust Score
High trust score
Estimated worth
Estimated daily income
Estimated monthly income

Rank summary

How is ranked relative to other sites:

Percentage of visits to from a search engine:

Frequently Asked Questions (FAQ)

Q: When was registered?
A: was registered 17 years, 11 months, 3 weeks, 14 hours, 6 minutes, 11 seconds ago on Sunday, January 26, 2003.
Q: When was the WHOIS for last updated?
A: The WHOIS entry was last updated 3 months, 3 days, 14 hours, 6 minutes, 11 seconds ago on Tuesday, October 13, 2020.
Q: What are's nameservers?
A: DNS for is provided by the following nameservers:
Q: Who is the registrar for the domain?
A: The domain has been registered at NAME.COM, INC..
Q: What is the traffic rank for
A: ranks 4,672 globally on Alexa. has a High trust score, and a Statvoo Rank of B.
Q: How many people visit each day?
A: receives approximately 356,462 visitors and 2,851,696 page impressions per day.
Q: What IP address does resolve to?
A: resolves to the IPv4 address
Q: In what country are servers located in?
A: has servers located in the United States.
Q: What webserver software does use?
A: is powered by CloudFlare webserver.
Q: Who hosts
A: is hosted by SoftLayer Technologies Inc. in Texas, Dallas, United States, 75270.
Q: How much is worth?
A: has an estimated worth of $3,080,160. An average daily income of approximately $2,852, which is roughly $86,748 per month. Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review Free SEO Report

Website Related Search Terms

Website Inpage Analysis for

H1 Headings

1 :
  1. The Developer Cloud Simplified

H2 Headings

3 :
  1. Infrastructure for Innovation
  2. A cloud experience developers love
  3. 11 Global Markets

H3 Headings

20 :
  1. Kubernetes
  2. Shared
  3. Dedicated CPU
  4. High Memory
  5. GPU
  6. Block Storage
  7. Object Storage
  8. Backups
  9. Cloud Firewall
  10. DDoS
  11. NodeBalancers
  12. DNS Manager
  13. Managed
  14. Professional Services
  15. API
  16. CLI
  17. Cloud Manager
  18. Monitoring
  19. Users & Permissions
  20. Marketplace

H4 Headings

19 :
  1. 800K+
  2. 11
  3. 2003
  4. 3
  5. 100%
  6. Award-Winning Support
  7. Predictable Pricing
  8. Cloud Simplified
  9. Get started today
  10. Follow Us
  11. Why Linode
  12. Products
  13. Solutions
  14. Marketplace
  15. Pricing
  16. Company
  17. Community
  18. Contact
  19. Follow Us

H5 Headings

0 :

H6 Headings

14 :
  1. Featured
  2. Why Linode
  3. Get to Know Us Better
  4. Featured
  5. Compute
  6. Storage
  7. Services
  8. Networking
  9. Developer Tools
  10. Featured
  11. Pricing
  12. Featured
  13. Community
  14. Engage With Us


1 :

Total Images

37 :

Google Adsense

Not Applicable

Google Analytics

Not Applicable

Links - Internal

  1. Linode Free Cloud Migration Limited Time Free Migration Service
  2. Linode Search
  3. Linode Partners
  4. Linode Docs
  5. Linode Support
  6. Linode Sales
  7. Linode Careers
  8. Linode Log In
  9. Linode Español
  10. Linode 日本語
  11. Linode Deutsch
  12. Linode Português
  14. Linode Solutions
  15. Linode Marketplace
  16. Linode Sign Up
  17. Linode Why Linode
  18. Linode Products
  19. Linode Pricing List
  20. Linode Community
  21. Linode About Us
  22. Linode Contact Sales
  23. Linode Press Center
  24. Linode Craft of Code:Cloudnet Reliability Allows Customers (and Cloudnet) To Do What They Love Read Cloudnet's Story
  25. Linode Choosing Linode
  26. Linode Support Experience
  27. Linode Predictable Pricing
  28. Linode Cloud Simplified
  29. Linode Global Infrastructure
  30. Linode About Linode
  31. Linode Customer Stories
  32. Linode Linode for Business
  33. Linode Alternative Cloud
  34. Linode Linode vs. AWS
  35. Linode Open Cloud
  36. Linode What is Cloud Computing?
  37. Linode GPUs have landed in Mumbai! On-demand GPUs for machine learning, scientific computing, and video processing. Try Today
  38. Linode View All Products
  39. Linode Shared
  40. Linode Dedicated CPU
  41. Linode High Memory
  42. Linode GPU
  43. Linode Bare Metal
  44. Linode Kubernetes
  45. Linode Block Storage
  46. Linode Object Storage
  47. Linode Backups
  48. Linode Managed
  49. Linode Professional Services
  50. Linode Cloud Firewall
  51. Linode DDoS Protection
  52. Linode DNS Manager
  53. Linode NodeBalancers
  54. Linode VLAN
  55. Linode Cloud Manager
  56. Linode Linode API
  57. Linode CLI
  58. Linode Images
  59. Linode Integrations
  60. Linode StackScripts
  61. Linode Monitoring
  62. Linode Users & Permissions
  63. Linode Total Cost of Ownership Calculator Migrating from on-premises or between cloud providers for hosting, cloud storage, or cloud computing? Launch Calculator
  64. Linode Cloud Estimator
  65. Linode TCO Calculator
  66. Linode New One Click App:Nextcloud Open source productivity and storage management platform. Deploy App
  67. Linode Overview
  68. Linode Q&A
  69. Linode Developer Portal
  70. Linode Blog
  71. Linode Beta Program
  72. Linode Content Resources
  73. Linode Events
  74. Linode Linode Video Channel
  75. Linode Newsletter
  76. Linode Affiliate Program
  77. Linode Customer Referral Program
  78. Linode Terms of Service.
  79. Linode What is Linode?
  80. Linode Price Comparison
  81. Linode Kubernetes Managed Kubernetes clusters
  82. Linode Shared Balanced power and performance
  83. Linode Dedicated CPU For CPU-intensive applications
  84. Linode High Memory Maximum RAM configurations
  85. Linode GPU Speed up complex compute jobs
  86. Linode Block Storage Reliable and scalable storage
  87. Linode Object Storage Simple content storage and delivery
  88. Linode Backups Safe and reliable cloud backups
  89. Linode Cloud Firewall Filter network traffic
  90. Linode DDoS Automatic DDoS mitigation
  91. Linode NodeBalancers Transparent and easy load distribution
  92. Linode DNS Manager Simple control over your DNS records
  93. Linode Managed Infrastructure management
  94. Linode Professional Services Cloud consulting & migration
  95. Linode API Manage Linode via our API
  96. Linode CLI Command line access to your Linodes
  97. Linode Cloud Manager Manage your resources in one easy interface
  98. Linode Monitoring Usability reporting and notifications
  99. Linode Users & Permissions User management and access control
  100. Linode Marketplace Deploy with preinstalled One-Click Apps
  101. Linode Explore Products
  102. Linode Award-Winning Support No tiers, no hand-offs, just highly trained service professionals who actually answer the phone and solve your issue 24/7/365.
  103. Linode Predictable Pricing Always know what you will pay monthly with flat and transparent pricing across every data center.
  104. Linode Cloud Simplified Easily manage and scale your infrastructure with our intuitive Cloud Manager, API/CLI, One-Click apps, and more.
  105. Linode Solutions Partner Program
  106. Linode Linode vs AWS
  107. Linode Tokyo, Japan
  108. Linode Mumbai, India
  109. Linode Singapore, Singapore
  110. Linode Sydney, Australia
  111. Linode Frankfurt, Germany
  112. Linode London, United Kingdom
  113. Linode Toronto, Canada
  114. Linode Newark, United States
  115. Linode Atlanta, United States
  116. Linode Dallas, United States
  117. Linode Fremont, United States
  118. Linode Run Speed Test
  119. Linode Create Free Account
  120. Linode View Pricing
  121. Linode See how Linode Cloud pricing compares
  122. Linode Products Overview
  123. Linode Solutions Overview
  124. Linode Browse Marketplace
  125. Linode Submit Marketplace App
  126. Linode About
  127. Linode Leadership
  128. Linode Legal
  129. Linode Subscription Center
  130. Linode Community Overview
  131. Linode API
  132. Linode Documentation
  133. Linode Distributions
  134. Linode Cloud Computing Terms
  135. Linode Contact Sales
  136. Linode System Status
  137. Linode Log in

Links - Internal (nofollow)


Links - Outbound (nofollow)


Keyword Cloud for

yourstorage objectloghighpartnersservicesstorageservicemigrationupcustomersupportddoslistsimplifiedlinode vs awscommunityprofessionalmemorylinode for businessmanagementcloud firewallexperienceproductslinodecareerscpudedicatedcenterlinode vssolutionspressapplicationsblock storageblockampcloud simplified24pxunitedyoutoolsvs awsglobalvscloudresourcesfeaturedoverviewprofessional servicesourbusinesscloud managergpureferralcodesupport experiencemanagerkuberneteshigh memoryfirewalldedicated cpubackupscloud computingdevelopercomputemanagedcontactcalculatorobjectwhy linodepricing listdnsunited statespredictable pricingobject storagepredictablestatesfreeapivideowhycomputingstorage object storagesalesnodebalancersawscontentpress centerprogramdns manageropenpricingnewmarketplaceinfrastructureshareduslet

Longtail Keyword Density for

linode for business3
linode vs aws3
storage object storage3
why linode4
cloud simplified4
cloud computing4
united states4
predictable pricing3
support experience3
linode vs3
vs aws3
press center3
pricing list3
high memory3
block storage3
storage object3
object storage3
professional services3
cloud firewall3
dns manager3
cloud manager3
dedicated cpu3

Who hosts Hosting Provider Information

Hosted IP Address:
Service Provider:SoftLayer Technologies Inc.
Hosted Country:United StatesUS
Location Latitude:32.7787
Location Longitude:-96.8218
Webserver Software:CloudFlare

Is "SoftLayer Technologies Inc." in the Top 10 Hosting Companies?

Percentage, LLC
DoD Network Information Center
Google Inc.
Confluence Networks Inc
2.6217%, Inc.
Namecheap, Inc.
TOT Public Company Limited
1&1 Internet AG
Merit Network Inc.
Unified Layer
SoftLayer Technologies Inc.

HTTP Header Analysis for

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Thu, 05 Nov 2020 15:20:19 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
cf-edge-cache: cache,platform=wordpress
Link:; rel=shortlink
X-Upstream: web1
Strict-Transport-Security: max-age=0
X-Frame-Options: DENY
CF-Cache-Status: HIT
Age: 1170
Expires: Thu, 05 Nov 2020 19:20:19 GMT
Cache-Control: public, max-age=14400
cf-request-id: 063a97a2b3000007a6a3af7000000001
Expect-CT: max-age=604800, report-uri=""
Vary: Accept-Encoding
Server: cloudflare
CF-RAY: 5ed78ee45a9907a6-LHR
Content-Encoding: gzip Domain Nameserver Information

HostIP AddressCountry

Need to find out who hosts

Domain Registration (WhoIs) information for

 Domain Name: LINODE.COM
Registry Domain ID: 94382922_DOMAIN_COM-VRSN
Registrar WHOIS Server:
Registrar URL:
Updated Date: 2020-10-06T14:12:17Z
Creation Date: 2003-01-26T00:03:21Z
Registrar Registration Expiration Date: 2025-01-26T00:03:21Z
Registrar:, Inc.
Registrar IANA ID: 625
Domain Status: clientTransferProhibited
Registry Registrant ID: Not Available From Registry
Registrant Name: Christopher Aker
Registrant Organization: Linode, LLC
Registrant Street: 329 E. Jimmie Leeds Road , Suite A
Registrant City: Galloway
Registrant State/Province: NJ
Registrant Postal Code: 08205
Registrant Country: US
Registrant Phone: Non-Public Data
Registrant Fax: +1.6093807200
Registrant Email:
Registry Admin ID: Not Available From Registry
Admin Name: Christopher Aker
Admin Organization: Linode, LLC
Admin Street: 329 E. Jimmie Leeds Road , Suite A
Admin City: Galloway
Admin State/Province: NJ
Admin Postal Code: 08205
Admin Country: US
Admin Phone: Non-Public Data
Admin Fax: +1.6093807200
Admin Email:
Registry Tech ID: Not Available From Registry
Tech Name: Christopher Aker
Tech Organization: Linode, LLC
Tech Street: 329 E. Jimmie Leeds Road , Suite A
Tech City: Galloway
Tech State/Province: NJ
Tech Postal Code: 08205
Tech Country: US
Tech Phone: Non-Public Data
Tech Fax: +1.6093807200
Tech Email:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
DNSSEC: unSigned
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.7203101849
URL of the ICANN WHOIS Data Problem Reporting System:
>>> Last update of WHOIS database: 2020-10-08T11:35:25Z

Websites with Similar Names
莉诺达斯 - 简单快捷的策略冒险类卡牌对战游戏 -
Cloud Hosting & Linux Servers | Linode | 521: Web server is down
Linode中文教程 - Linode - Xen VPS Hosting

Recently Updated Websites (1 second ago.) (1 second ago.) (2 seconds ago.) (2 seconds ago.) (3 seconds ago.) (3 seconds ago.) (3 seconds ago.) (3 seconds ago.) (4 seconds ago.) (4 seconds ago.) (4 seconds ago.) (5 seconds ago.) (5 seconds ago.) (5 seconds ago.) (5 seconds ago.) (5 seconds ago.) (6 seconds ago.) (6 seconds ago.) (6 seconds ago.) (6 seconds ago.) (6 seconds ago.) (7 seconds ago.) (7 seconds ago.) (7 seconds ago.) (8 seconds ago.) (8 seconds ago.) (9 seconds ago.) (9 seconds ago.) (9 seconds ago.) (9 seconds ago.)

Recently Searched Keywords

artistcount1valuemusiccount1valueskogmancount1valuethorecount1valuewith (3 seconds ago.)hari280011tl sepete ekle (5 seconds ago.)beda (6 seconds ago.)mobile bar (7 seconds ago.)рентгенологические исследования (7 seconds ago.)паллиативная помощь при раке (8 seconds ago.)помощь на дому (9 seconds ago.)получение налогового вычета (10 seconds ago.)дерматовенеролог (11 seconds ago.)bị tố “lừa đảo” – bạn có thật sự hiểu về mô hình nghỉ dưỡng mới đến từ resorts international việt nam (11 seconds ago.)диетолог (12 seconds ago.)covid-19 - (14 seconds ago.)安卓资源 (15 seconds ago.)207-98-70 (15 seconds ago.)mn ndrerit (15 seconds ago.)inputtyperadiolabel (16 seconds ago.)кольпоскопия (16 seconds ago.)кардиология (17 seconds ago.)加盟合作 (17 seconds ago.)中大面料 (18 seconds ago.)гематолог (18 seconds ago.)代表メッセージ (18 seconds ago.) (19 seconds ago.)стоимость услуг наличный и безналичный расчет (19 seconds ago.)ээг (20 seconds ago.)поликлиника омс (23 seconds ago.)style-kgl6qj0ibg (24 seconds ago.)ректороманоскопия (24 seconds ago.)tác dụng tuyệt vời của tổ yến loại 1 mang lại sức khỏe – chia sẻ từ yến sào việt phúc (25 seconds ago.)pleinairpottery (25 seconds ago.)