Llewellyn.info

Website Thumbnail
Checking...

Safety: Low trust score
Year Founded: 2016
Global Traffic Rank: Unknown
Estimated Worth: $9
Last updated:2020-05-12
Category: This site has not been categorized yet


Domain summary

Domain label
llewellyn
Domain extension
info
Domain registered:
2016-04-13
Domain updated:
2020-05-12
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is llewellyn.info ranked relative to other sites:

Percentage of visits to llewellyn.info from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Llewellyn.info registered?
A: Llewellyn.info was registered 4 years, 7 months, 2 weeks, 5 days, 15 hours, 28 minutes, 46 seconds ago on Wednesday, April 13, 2016.
Q: When was the WHOIS for Llewellyn.info last updated?
A: The WHOIS entry was last updated 6 months, 3 weeks, 15 hours, 28 minutes, 46 seconds ago on Tuesday, May 12, 2020.
Q: What are Llewellyn.info's nameservers?
A: DNS for Llewellyn.info is provided by the following nameservers:
  • ns67.domaincontrol.com
  • ns68.domaincontrol.com
Q: Who is the registrar for the Llewellyn.info domain?
A: The domain has been registered at Afilias Global Registry Services.
Q: What is the traffic rank for Llewellyn.info?
A: Llewellyn.info has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Llewellyn.info each day?
A: Llewellyn.info receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Llewellyn.info resolve to?
A: Llewellyn.info resolves to the IPv4 address 50.63.202.61.
Q: In what country are Llewellyn.info servers located in?
A: Llewellyn.info has servers located in the United States.
Q: What webserver software does Llewellyn.info use?
A: Llewellyn.info is powered by Microsoft-IIS/7.5 webserver.
Q: Who hosts Llewellyn.info?
A: Llewellyn.info is hosted by GoDaddy.com, LLC in Arizona, Scottsdale, United States, 85260.
Q: How much is Llewellyn.info worth?
A: Llewellyn.info has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Llewellyn.info Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Llewellyn.info Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Llewellyn.info

H1 Headings

0 :

H2 Headings

0 :

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

0 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

1:

Links - Internal (nofollow)

1:

Links - Outbound

1:

Links - Outbound (nofollow)

1:

Who hosts Llewellyn.info?

Llewellyn.info Hosting Provider Information

Hosted IP Address:50.63.202.61
Hosted Hostname:ip-50-63-202-61.ip.secureserver.net
Service Provider:GoDaddy.com, LLC
Hosted Country:United StatesUS
Location Latitude:33.6013
Location Longitude:-111.8867
Webserver Software:Microsoft-IIS/7.5

Is "GoDaddy.com, LLC" in the Top 10 Hosting Companies?

Name
Percentage
GoDaddy.com, LLC
9.5100%
DoD Network Information Center
8.4509%
Google Inc.
2.8338%
Confluence Networks Inc
2.6217%
Amazon.com, Inc.
2.1737%
Namecheap, Inc.
2.1384%
TOT Public Company Limited
1.5665%
1&1 Internet AG
1.5512%
Merit Network Inc.
1.3856%
Unified Layer
1.3043%

HTTP Header Analysis for Llewellyn.info

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Cache-Control: no-cache
Pragma: no-cache
Content-Type: text/html; charset=utf-8
Content-Encoding: gzip
Expires: -1
Vary: Accept-Encoding
Server: Microsoft-IIS/7.5
X-AspNet-Version: 4.0.30319
X-Powered-By: ASP.NET
Date: Tue, 12 May 2020 06:03:23 GMT
Content-Length: 440
Age: 0
Connection: keep-alive

Llewellyn.info Domain Nameserver Information

HostIP AddressCountry
ns67.domaincontrol.com 97.74.103.44
ns68.domaincontrol.com 173.201.71.44


Need to find out who hosts Llewellyn.info?


Domain Registration (WhoIs) information for Llewellyn.info

 Domain Name: LLEWELLYN.INFO
Registry Domain ID: D503300000007966359-LRMS
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.godaddy.com
Updated Date: 2020-04-14T15:35:04Z
Creation Date: 2016-04-13T02:50:05Z
Registry Expiry Date: 2021-04-13T02:50:05Z
Registrar Registration Expiration Date:
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.4806242505
Reseller:
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Domain Status: autoRenewPeriod https://icann.org/epp#autoRenewPeriod
Registrant Organization: Serene Endeavors
Registrant State/Province: South Carolina
Registrant Country: US
Name Server: NS67.DOMAINCONTROL.COM
Name Server: NS68.DOMAINCONTROL.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form is https://www.icann.org/wicf/
>>> Last update of WHOIS database: 2020-05-12T06:02:24Z

Websites with Similar Names

Llewebtech.com
llewebtech.com – ??????????.com??????????
Llewedding.com
Kendal & Patrick — Minted
Llewellinkennels.com
Wellnesszap.com
Llewellinpuppies.com
Home of Mitchell's Llewellin Setters

Recently Updated Websites

Marissasbeauty.com (3 seconds ago.)Janetmetcalfe.com (7 seconds ago.)Ldmvp974.com (7 seconds ago.)Jeremyssidehustle.com (8 seconds ago.)Javierpenajewellry.com (12 seconds ago.)Myrsinialexandridi.com (14 seconds ago.)Misssory.com (15 seconds ago.)Monparfumgenerique.com (16 seconds ago.)Mccarepackages.com (17 seconds ago.)Hxqxyz.com (17 seconds ago.)Introvert-academy.com (18 seconds ago.)Jusepen.com (18 seconds ago.)Myfoodbundle.com (19 seconds ago.)Huesthecollections.com (20 seconds ago.)Ixix900.com (21 seconds ago.)Lizziecurves.com (21 seconds ago.)Jetracingbmx.com (24 seconds ago.)Joshandlaura2020.com (24 seconds ago.)Jotindronathgps.com (25 seconds ago.)Issen-kushikatsu.com (26 seconds ago.)Jamesmolinero.com (26 seconds ago.)Iamhoujunjie.com (28 seconds ago.)Internationalcallsnow.com (29 seconds ago.)Merakidesign-hh.com (29 seconds ago.)Medameltz.com (30 seconds ago.)Limpezaactiva.com (31 seconds ago.)Licensediary.com (32 seconds ago.)Mistymountainconsulting.com (33 seconds ago.)Jj6522.com (34 seconds ago.)Medaillejo24.com (34 seconds ago.)

Recently Searched Keywords

tasi (2 seconds ago.)property schemes in dholera (4 seconds ago.)your richlinktargetblanktypewixdatapageiduc43atargetselftypepagelinkpagenamesan miguel (6 seconds ago.)slut (6 seconds ago.)0 0 10px (6 seconds ago.)chuck hughes chef (8 seconds ago.)chuck hughes nfl (8 seconds ago.)missing woman in colorado (8 seconds ago.)lihangchuye (9 seconds ago.)missing women 2020 (9 seconds ago.)maykadeh reservations (9 seconds ago.)loan 2017 8211 (11 seconds ago.)partir (11 seconds ago.)jenny markovich (11 seconds ago.)non effusive comments (12 seconds ago.)duit apk (12 seconds ago.)katılımcı belediyecilik anlayışı (14 seconds ago.)kevin burke (14 seconds ago.)national geographic travel books (14 seconds ago.)mike judge twitter (14 seconds ago.)mk games (14 seconds ago.)jenny marketou (15 seconds ago.)mk games google sites (15 seconds ago.)maykadeh menu (15 seconds ago.)hhh.h_keyword (15 seconds ago.)duitku plugin (15 seconds ago.)commercial drivers license (15 seconds ago.)mini drone 4k (15 seconds ago.)social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-icons (16 seconds ago.)bundesliga (16 seconds ago.)