Lloydsbank.co.uk  |  Lloyds Bank - Personal Banking, Personal Finances & Bank Accounts
High trust score  | 
Wherever you want to get to in life, Lloyds Bank has a range of bank accounts and personal banking services to suit you. Visit us today to find out more

Lloydsbank.co.uk Website Information

Website Ranks & Scores for Lloydsbank.co.uk

Statvoo Rank Statvoo Rank:B
Alexa Rank Alexa Rank:1,473
Majestic Rank Majestic Rank:0
Domain Authority Domain Authority:34%
DMOZ DMOZ Listing:No

Whois information for lloydsbank.co.uk

Full Whois Lookup for Lloydsbank.co.uk Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Lloydsbank.co.uk. Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

Domain name:

Lloyds Bank Plc

Registrant type:
UK Public Limited Company, (Company number: 02065)

Registrant's address:
25 Gresham Street
United Kingdom

Data validation:
Nominet was able to match the registrant's name and address against a 3rd party data source on 28-Jul-2017

Registered through:
NetNames Limited
URL: http://www.netnames.co.uk

Ascio Technologies Inc. Denmark ? filial af Ascio Technologies Inc. USA t/a Ascio Technologies inc [Tag = ASCIO]
URL: http://www.ascio.com

Relevant dates:
Registered on: before Aug-1996
Expiry date: 05-Aug-2019
Last updated: 04-Aug-2017

Registration status:
Registered until expiry date.

Name servers:

WHOIS lookup made at 19:01:45 13-Sep-2017

This WHOIS information is provided for free by Nominet UK the central registry
for .uk domain names. This information and the .uk WHOIS are:

Copyright Nominet UK 1996 - 2017.

You may not access the .uk WHOIS or use any data from it except as permitted
by the terms of use available in full at http://www.nominet.uk/whoisterms,
which includes restrictions on: (A) use of the data for advertising, or its
repackaging, recompilation, redistribution or reuse (B) obscuring, removing
or hiding any or all of this notice and (C) exceeding query rate or volume
limits. The data is provided on an 'as-is' basis and may lag behind the
register. Access may be withdrawn or restricted at any time.

Who hosts Lloydsbank.co.uk?

Lloydsbank.co.uk is hosted by Lloyds Banking Group PLC in United Kingdom.
Lloydsbank.co.uk has an IP Address of and a hostname of

Lloydsbank.co.uk Web Server Information

Hosted IP Address:
Hosted Hostname:
Service Provider:Lloyds Banking Group PLC
Hosted Country:United KingdomGB
Location Latitude:51.5
Location Longitude:-0.13
Webserver Software:unknown
Google Map of 50,12

Websites Hosted on Same IP (i.e.

Lloyds Bank - Personal Banking, Personal Finances & Bank Accounts
- lloydstsb.co.uk

Wherever you want to get to in life, Lloyds Bank has a range of bank accounts and personal banking services to suit you. Visit us today to find out more

  555,459   $ 1,680.00

Lloyds Bank - Personal Banking, Personal Finances & Bank Accounts
- lloydstsb.com

Wherever you want to get to in life, Lloyds Bank has a range of bank accounts and personal banking services to suit you. Visit us today to find out more

  26,496   $ 426,240.00

Lloyds Bank - Personal Banking, Personal Finances & Bank Accounts
- lloydsbank.com

Wherever you want to get to in life, Lloyds Bank has a range of bank accounts and personal banking services to suit you. Visit us today to find out more

  3,460   $ 3,471,120.00

HTTP Header Analysis for Lloydsbank.co.uk

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Cache-Control: private
Date: Mon, 08 Jun 2015 07:17:28 GMT
Content-Type: text/html
X-Powered-By: ASP.NET
Content-Encoding: gzip
Vary: Accept-Encoding
Transfer-Encoding: chunked

Need to find out who hosts Lloydsbank.co.uk?

Lloydsbank.co.uk Free SEO Report

Website Inpage Analysis for Lloydsbank.co.uk

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Lloydsbank.co.uk

travel services0 balancemoreme securelikeloanmortgagebusinessvarways to bankcustomer supportlosttake a lookbalance transfermanaginghelp and supportus manage yourcurrent accountslloyds bankwaysloansbackcurrentauthoritycardallproductsbereavementfinancialus managesearchlloyds banking servicefind out morehome insurancecash isasupportinternetaccounts creditpersonal financialnewdealingtelephonesupport helpadvice service helpyearhelpmobile bankingnextprivatebanking mobile bankingyour next stepshare dealingtransfer1banking mobiletoolsnoaskour products allservice helplloyds bank plconline bankingcar financeourmortgagesalready have0 balance transferstolenalreadyaccount with ustypesecureyour financeshaveratesbank plceligiblehometransfer cardplccreditadviceskipfilterreleasesmoneylike to applyyour nextbalancetakestudent accountisasgetyour accountchargesplanning yourwebsitecredit cardsguidanceaccesscredit cardoutfixedinvestmentlost or stolenbanking serviceonlineaccountyour moneycustomerour productskeep me securebranchexistingbank wayspersonalrates and chargeslogout moreinsurancebuying a carcontact usyourregister for internetimstep0ustravellloydsabroadfindenglandfinancial advicelookinterested in carisaaccountsinvestmentscallsinternet bankinglloyds bankingregistergoingsavingsfind a branchcashsharehelp and guidanceapplykeepnext stepmefinancial advice servicecontactbuyingserviceusemanagebanking with usbanking onlinefinancebankweretirementbalance transfer cardfind outmanage yourstudentinterestedproducts allkeep mepressregisteredpagecustomersyouoverviewadvice servicemobileplanningcardsinformationservicescarmanaging yourfinancesinternationalpersonal financial advicebankingpress releasesneed

Longtail Keyword Density for Lloydsbank.co.uk

find out more14
help and guidance10
our products all6
personal financial advice6
balance transfer card5
financial advice service5
like to apply4
help and support4
interested in car4
advice service help4
lloyds banking service4
keep me secure4
register for internet3
banking mobile banking3
take a look3
lloyds bank plc3
find a branch3
ways to bank3
banking with us3
rates and charges3
0 balance transfer3
us manage your3
buying a car3
your next step3
account with us3
lost or stolen3
lloyds bank17
internet banking15
find out14
out more14
our products13
share dealing9
already have9
car finance8
personal financial7
financial advice7
credit card6
products all6
credit cards6
transfer card5
balance transfer5
manage your5
advice service5
keep me5
lloyds banking5
me secure5
current accounts5
mobile banking4
home insurance4
banking mobile4
banking online4
banking service4
travel services4
service help4
cash isa4
your finances3
bank ways3
planning your3
managing your3
your account3
bank plc3
student account3
your money3
online banking3
customer support3
press releases3
0 balance3
contact us3
support help3
your next3
us manage3
next step3
accounts credit3

What are the nameservers for lloydsbank.co.uk?

Lloydsbank.co.uk Domain Nameserver Information

HostIP AddressCountry
ns2.lloydstsb.co.uk Kingdom United Kingdom
ns4.lloydstsb.com Kingdom United Kingdom
ns5.lloydstsb.net Kingdom United Kingdom

Lloydsbank.co.uk DNS Record Analysis DNS Lookup

lloydsbank.co.ukNS28800Target: ns4.lloydstsb.com
lloydsbank.co.ukNS28800Target: ns2.lloydstsb.co.uk
lloydsbank.co.ukNS28800Target: ns5.lloydstsb.net
lloydsbank.co.ukSOA28800MNAME: ns2.lloydstsb.co.uk
RNAME: dnsreg.lloydstsb.co.uk
Serial: 186
Refresh: 10800
Retry: 3600
Expire: 2592000
lloydsbank.co.ukMX28800Priority: 5
Target: cluster5.eu.messagelabs.com
lloydsbank.co.ukMX28800Priority: 10
Target: cluster5a.eu.messagelabs.com
lloydsbank.co.ukTXT28800TXT: v=spf1 mx include:spf.messagelabs.com
include:spf.isb21.com ip4:
ip4: -all

Alexa Traffic Rank for Lloydsbank.co.uk

Alexa Search Engine Traffic for Lloydsbank.co.uk