LovelyBooks - Leser empfehlen Dir die besten Bücher und Autoren

Safety: Low trust score
Year Founded: 2020
Global Traffic Rank: 65,983
Estimated Worth: $192,240

Dein Guide für Bücher - der Treffpunkt für Leser: Entdecke Bücher und Autoren auf eine neue Art - dazu die schönsten Buchverlosungen ...



Domain summary

Last updated
2020-10-15
Domain label
lovelybooks
Domain extension
de
Global Traffic Rank
65,983
Statvoo Rating
E
Trust Score
Low Trust Score
Estimated worth
$192,240
Estimated daily income
$267
Estimated monthly income
$8,121

Frequently Asked Questions (FAQ)

Q: When was Lovelybooks.de registered?
A: Lovelybooks.de was registered 8 months, 6 days, 11 hours, 14 seconds ago on Thursday, October 15, 2020.
Q: When was the WHOIS for Lovelybooks.de last updated?
A: The WHOIS entry was last updated 4 years, 6 months, 4 weeks, 1 day, 11 hours, 14 seconds ago on Tuesday, November 22, 2016.
Q: What are Lovelybooks.de's nameservers?
A: DNS for Lovelybooks.de is provided by the following nameservers:
  • ns.udag.de
  • ns.udag.net
  • ns.udag.org
Q: Who is the registrar for the Lovelybooks.de domain?
A: The domain has been registered at DENIC eG.
Q: What is the traffic rank for Lovelybooks.de?
A: Lovelybooks.de ranks 65,983 globally on Alexa. Lovelybooks.de has a Low Trust Score, and a Statvoo Rank of E.
Q: How many people visit Lovelybooks.de each day?
A: Lovelybooks.de receives approximately 22,246 visitors and 133,476 page impressions per day.
Q: What IP address does Lovelybooks.de resolve to?
A: Lovelybooks.de resolves to the IPv4 address 136.243.41.28.
Q: In what country are Lovelybooks.de servers located in?
A: Lovelybooks.de has servers located in the Germany.
Q: What webserver software does Lovelybooks.de use?
A: Lovelybooks.de is powered by webserver.
Q: Who hosts Lovelybooks.de?
A: Lovelybooks.de is hosted by Hetzner Online GmbH in Germany.
Q: How much is Lovelybooks.de worth?
A: Lovelybooks.de has an estimated worth of $192,240. An average daily income of approximately $267, which is roughly $8,121 per month.

Lovelybooks.de Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Lovelybooks.de Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Lovelybooks.de

H1 Headings

1 :
  1. Entdecke dein neues Lieblingsbuch

H2 Headings

3 :
  1. In Roman-Listen stöbern
  2. LovelyBooks ChartsZu den Top 20 Charts
  3. Neue Rezensionen

H3 Headings

6 :
  1. Was ist LovelyBooks?
  2. Buchliebe für dein Mailpostfach
  3. Hol dir mehr von LovelyBooks
  4. Stöbern
  5. Infos
  6. Katalog

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

52 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

96:

Links - Internal (nofollow)

1:

Links - Outbound

4:

Links - Outbound (nofollow)

4:

Keyword Cloud for Lovelybooks.de

allemdamarisdykjulia dippelcryptos spannendervornemagische geschichte diemit der hauptprotagonistindemdie buumlcher derbchererde quotizara verbrannteich bin durchgeflogencardeadie michyearklimadebatteeine grandioseotera goldenauf derdoch alsmanndenstarken hauptcharakterbegeistert konntefischer elbendunkelfr eine grandiosezulebtich liebegraceberrascht berhrtist sietolleslebenum michcharakteren marasbelovedbooksnamina fornaamsiert damarisdykjulia dippelsehr temporeicher handlungdie gttinnennicht mehr aufhrenvereint es hatgeschichte die michich die kssemuss1 kein wegreiennachhauptcharakter sehr interessanteklimadebatte vereintseitdemluisekissezbookslaura cardea splitterercursed die hoffnungliegt hinterlberdippel izarainsschockiertmenschenunglaublichautorintop 20nichthocker zu reiendieweg zurck jugendbuchtypischeyou unglaublich suedeutschenich liebe diesebestenkagaliamara andeckvom hocker zubuchkategorienwiedereinem starkenl armentrout cursedist definitiv einso fallssue youngmit sehrihrverbrannte erde quotizaraquotizarasplitter ausfinale fr einebuchwunder ampgeschichte hatmit tollen charakterentolltemporeichermehrgolden wieihrentopwirdgttinnen vonmarasbelovedbooksnaminahockervermisse fortsetzungbildgewaltigarmentroutblutadels schnes finalemich begeistert konntezu wunder ampksse geschichte hattolle protagonisten readlovewriteroseallesmit sehr temporeicherich dich vermissegroartighintersoeis wowdiese reihegefehlt umreadlovewriteroseweltzu reienvomsueprotagonisten readlovewriterose snowmich vom hockerbluttolles buchich binsplitter aus silberstehteine magischeamp sogeschichte hat michhandlung skylineofbooksmarisa kanternicht mehrdurchgeflogenschonliggettgar nicht mehrfesselt berraschthinter derliebe diesereihe luisekissezbookskim liggettyoung adult geschichtesiefalls ich dichtolle protagonistennoch eingar nichtgrundzge mitmit ihrer2jugendlichejugendbuchtypische grundzgearmentrout cursedannalenchenrenawie blut kmpferischskylineofbooksmarisadich vermisse fortsetzungbisschen was gefehltdippel izara verbrannteoderluisekissezbookskim liggetthalleluzcryptoscharakterenklimadebatte vereint esdassseinein tollesesberhrt schockiertkommenwenngefehlt um michgttinnendiesemarasbelovedbooksnamina forna dieich diedie ksseautorin mithinten fesseltgeschichte tollvonsehr interessante geschichtebuumlchergernefr einegroartig ichhoffnungalsvorne bis hinteninteressante geschichteneuefinale ich liebekonnte gar nichtcursedkonnteumdritte buch desder vrdes blutadelshoffnung liegt hinterwirdanndrittezurcksue young adultmich von vorneein winzig bisschenquotizara verbranntegeschichteerde istcardea splitterabermehr aufhren zuerebossindmit einem starkendie ksse geschichtegroartig ich binso falls ichreadlovewriterose snowrose snowunglaublich sue youngvom hockeryouspannender jugendthriller derwiebislesergeschichte diedamarisdykjuliaihrer familiesilbermitfhlen luisekissezbookslaura cardeacharakteren marasbelovedbooksnaminaepisches finalediese reihe luisekissezbookskimadult geschichte mitsofalls ichpoznanski cryptosder dunkelheitmit ihrer familieblut kmpferisch bildgewaltiguntergaryoung adultleserundengeschichte mit tollenfortsetzung zuizara verbranntefalls ichmitfhlenliliennochbuch deramsiertgttinnen von oteraizara verbrannte erdekagaliamararoseepisches finale freinefelizelursula poznanskireien kagaliamarakagaliamara andeck wunderampsnow 3zurck jugendbuchtypischebuch der autorindes blutadels schnestemporeicher handlung3 lilien dasgehenmdchentollen charakterenvielliegt hinter dererde quotizaracursed dievorvereintichjugendbuchtypische grundzge mitlovelybookssplitterumgesetztfinale frblutadels schneskeinsogarluisekissezbookslaura cardeaamp so fallsaber noch eincardea splitter ausfamilieauchfesselt berrascht berhrtbis hintenteilweise sogarfortsetzung zu wunderwowdass sietemporeicher handlung skylineofbooksmarisaerde ist definitivdicharmentrout cursed diefischer elbendunkel 1fesselnd umgesetzt felizelursulahat michvon otera goldenwurdecryptos spannender jugendthrillerdefinitivkmpferisch bildgewaltigdie hoffnung liegtforna dieksse geschichtel armentroutdippelyear groartigausgrundzge mit sehrerdekonnte mit der1 keinum mich vomamp sofalls ichdunkelheit ein tolleshinter der dunkelheitihremfinale ichfesseltschreibtvon vorne bisautorenmeistgelesenesehr interessantefesselndtolleteilweise sogar amsierttollendie mich vonfischerreadlovewriterose snow 3skylineofbooksmarisa kanterhocker zuspannenderwinzigbildgewaltig tollekein weg zurckder hauptprotagonistingrandiose reihevermisseadult geschichtemitfhlen luisekissezbookslauraluisekissezbookslaurabisschenkonnte mitdabeiwinzig bisschenverbrannteizaragrundzgeadulteinaufhren zu lesendunkelheit einyoungfrhauptcharakteryorkforna die gttinnennewpoznanski cryptos spannenderweg zurckbegeistert konnte garfinaleepischesder autorin mitreihe luisekissezbookskimwunderteilweiseelbendunkelsnowlikereihenoch ein winziggeschichte mitgolden wie blutvrwerdenvon oteragrace yeargeborenerfolgreichdefinitiv einembertollen charakteren marasbelovedbooksnaminagefehltstarken hauptcharakter sehramsiert damarisdykjuliahauptprotagonistinmitmagische geschichtebuch desvorne bisautorin mit einemso mitfhlen luisekissezbookslaurafr eine magischegrace year groartigsnow 3 lilienmich begeistertinteressante geschichte tollhauptprotagonistin soromanvermisse fortsetzung zudas dritte buchwegeine magische geschichteyou unglaublichnew yorkzu lesenoteratoll und fesselndgrandiosevor allemtolles buch deryear groartig ichschockiert und teilweiseandeckaber nochder autorinaufhrenfuumlrderbesten bcherschnes finale ichkein wegihrerfesselnd umgesetztbindesmit derdortals siewow was frsofalls ich dieblut kmpferisch3 lilienvr und klimadebatteistannalenchenrena fischer elbendunkelzu reien kagaliamaraihrelesendamarisdykjulia dippel izaraarireien kagaliamara andeckzu wundermich vomjugendthrillersehr temporeicherlesen annalenchenrenagelungenesein tolles buchbegeistertsehrquotizara verbrannte erdefelizelursulavon vorneschnes finaleprotagonisten readlovewriteroseein gelungenesvereint esnashsogar amsiert damarisdykjuliainteressantekonnte garmit einemmaraist diedie besten bcheraufhren zukmpferischzu lesen annalenchenrenaliebenfallsverbrannte erde istdie hoffnungliebe diese reihelilien das drittebeililien dasandeck wunder ampdurchgeflogen und konntelike about youdefinitiv ein gelungeneswie bluteiswunder amp sodashatzurck jugendbuchtypische grundzgeaufmehr aufhrenso mitfhlenelbendunkel 1 keinspannender jugendthrillerfortsetzungumgesetzt felizelursulaliggett the graceschnesjugendthriller der vrberhrtschwesterdennelbendunkel 1jugendthriller dereinemjugendbuchtypischeberrascht berhrt schockiertdurchhinten fesselt berraschtdie gttinnen vonstarkeneinem starken hauptcharakterfelizelursula poznanski cryptosaus silberdritte buchhat abermagischemarasbelovedbooksnamina fornadas dritteeinerimeine grandiose reihedie bestenist definitivfornahoffnung liegtgoldenkssesofallsliegtverlagdurch dieotera golden wiesilber und eissichhauptprotagonistin so mitfhlendich vermissedochblutadelsbuumlcher derunglaublich sueliebe1bin durchgeflogenpoznanski0handlungder hauptprotagonistin soumgesetzt felizelursula poznanskidunkelheitkmpferisch bildgewaltig tollehat aber nochich dichkantermit tollenwunder amp sofallssogar amsierthat mich begeistertluisekissezbookskimnurlesen annalenchenrena fischerverbrannte erdeimmerandeck wunderschreibenhauptcharakter sehres hatannalenchenrena fischerprotagonistenberraschtmichamp sofallsbuch des blutadelszurder dunkelheit einmich vondie buumlcherleserunden ampbis hinten fesseltes hat aberhandlung skylineofbooksmarisabildgewaltig tolle protagonistenhintengelungenes und epischesein winzig

Longtail Keyword Density for Lovelybooks.de

KeywordsOccurences
das dritte buch6
dritte buch des6
lilien das dritte6
hoffnung liegt hinter5
liegt hinter der5
gttinnen von otera5
geschichte die mich4
nicht mehr aufhren4
gar nicht mehr4
konnte gar nicht4
begeistert konnte gar4
mich begeistert konnte4
hat mich begeistert4
magische geschichte die4
von vorne bis4
die mich von4
mich von vorne4
so-falls ich die4
eine magische geschichte4
vorne bis hinten4
hinten fesselt berrascht4
fesselt berrascht berhrt4
berrascht berhrt schockiert4
schockiert und teilweise4
mehr aufhren zu4
hauptprotagonistin so mitfhlen4
fr eine magische4
young adult geschichte4
buch des blutadels4
finale ich liebe4
ich liebe diese4
otera golden wie4
von otera golden4
die gttinnen von4
geschichte mit tollen4
adult geschichte mit4
sue young adult4
1 kein weg4
ich bin durchgeflogen4
durchgeflogen und konnte4
konnte mit der4
mit der hauptprotagonistin4
der hauptprotagonistin so4
mit sehr temporeicher4
grundzge mit sehr4
so falls ich4
falls ich dich4
bis hinten fesselt4
buch der autorin4
toll und fesselnd4
finale fr eine4
episches finale fr4
gelungenes und episches4
erde ist definitiv4
tolles buch der4
ist definitiv ein4
definitiv ein gelungenes4
interessante geschichte toll4
die hoffnung liegt4
sehr interessante geschichte4
hauptcharakter sehr interessante4
starken hauptcharakter sehr4
einem starken hauptcharakter4
mit einem starken4
autorin mit einem4
der autorin mit4
verbrannte erde ist4
fr eine grandiose4
jugendthriller der vr4
noch ein winzig4
vom hocker zu4
mich vom hocker4
um mich vom4
gefehlt um mich4
bisschen was gefehlt4
vr und klimadebatte4
ein winzig bisschen4
aber noch ein4
hat aber noch4
es hat aber4
vereint es hat4
klimadebatte vereint es4
diese reihe luisekissezbookskim3
reihe luisekissezbookskim liggett3
liebe diese reihe3
grace year groartig3
schnes finale ich3
blutadels schnes finale3
liggett the grace3
des blutadels schnes3
eine grandiose reihe3
die buumlcher der3
teilweise sogar amsiert3
so mitfhlen luisekissezbookslaura3
year groartig ich3
quotizara verbrannte erde3
amsiert damarisdykjulia dippel3
damarisdykjulia dippel izara3
dippel izara verbrannte3
izara verbrannte erde3
verbrannte erde quotizara3
erde quotizara verbrannte3
wow was fr3
groartig ich bin3
silber und eis3
splitter aus silber3
cardea splitter aus3
luisekissezbookslaura cardea splitter3
mitfhlen luisekissezbookslaura cardea3
sogar amsiert damarisdykjulia3
die besten bcher3
you unglaublich sue3
3 lilien das3
reien kagaliamara andeck3
ich die ksse3
amp so-falls ich3
wunder amp so-falls3
zu wunder amp3
fortsetzung zu wunder3
vermisse fortsetzung zu3
dich vermisse fortsetzung3
ich dich vermisse3
amp so falls3
wunder amp so3
andeck wunder amp3
kagaliamara andeck wunder3
zu reien kagaliamara3
ksse geschichte hat3
hocker zu reien3
spannender jugendthriller der3
cryptos spannender jugendthriller3
poznanski cryptos spannender3
felizelursula poznanski cryptos3
umgesetzt felizelursula poznanski3
fesselnd umgesetzt felizelursula3
ein tolles buch3
dunkelheit ein tolles3
der dunkelheit ein3
hinter der dunkelheit3
cursed die hoffnung3
armentrout cursed die3
die ksse geschichte3
geschichte hat mich3
snow 3 lilien3
unglaublich sue young3
readlovewriterose snow 33
protagonisten readlovewriterose snow3
tolle protagonisten readlovewriterose3
bildgewaltig tolle protagonisten3
kmpferisch bildgewaltig tolle3
blut kmpferisch bildgewaltig3
wie blut kmpferisch3
golden wie blut3
forna die gttinnen3
marasbelovedbooksnamina forna die3
charakteren marasbelovedbooksnamina forna3
tollen charakteren marasbelovedbooksnamina3
mit tollen charakteren3
l armentrout cursed3
aufhren zu lesen3
like about you3
handlung skyline-of-booksmarisa kanter3
temporeicher handlung skyline-of-booksmarisa3
sehr temporeicher handlung3
jugendbuchtypische grundzge mit3
zurck jugendbuchtypische grundzge3
weg zurck jugendbuchtypische3
kein weg zurck3
elbendunkel 1 kein3
fischer elbendunkel 13
anna-lenchenrena fischer elbendunkel3
lesen anna-lenchenrena fischer3
zu lesen anna-lenchenrena3
mit ihrer familie3
lilien das8
fr eine8
buch des8
verbrannte erde7
von otera6
wunder amp6
das dritte6
dritte buch6
nicht mehr5
gttinnen von5
mit einem5
hinter der5
mit der5
liegt hinter5
hoffnung liegt5
die hoffnung5
vorne bis4
bis hinten4
hinten fesselt4
fesselt berrascht4
sehr temporeicher4
mit sehr4
grundzge mit4
mich begeistert4
teilweise sogar4
berrascht berhrt4
berhrt schockiert4
mehr aufhren4
begeistert konnte4
kein weg4
konnte gar4
gar nicht4
sue young4
1 kein4
aufhren zu4
von vorne4
geschichte die4
young adult4
bildgewaltig tolle4
konnte mit4
der hauptprotagonistin4
liebe diese4
ich liebe4
finale ich4
hauptprotagonistin so4
so mitfhlen4
des blutadels4
aus silber4
eine magische4
top 204
golden wie4
otera golden4
die gttinnen4
magische geschichte4
ich bin4
die mich4
mich von4
mit tollen4
geschichte mit4
hat mich4
adult geschichte4
ich die4
hauptcharakter sehr4
noch ein4
aber noch4
hat aber4
es hat4
klimadebatte vereint4
der vr4
jugendthriller der4
geschichte toll4
interessante geschichte4
sehr interessante4
starken hauptcharakter4
winzig bisschen4
einem starken4
autorin mit4
der autorin4
buch der4
tolles buch4
rose snow4
durch die4
die buumlcher4
l armentrout4
die besten4
ein winzig4
vereint es4
gefehlt um4
um mich4
so-falls ich4
erde ist4
zu wunder4
ist definitiv4
definitiv ein4
ein gelungenes4
ich dich4
falls ich4
so falls4
bin durchgeflogen4
episches finale4
mich vom4
vom hocker4
hocker zu4
eine grandiose4
finale fr4
new york3
erde quotizara3
mit ihrer3
auf der3
buumlcher der3
ist die3
grandiose reihe3
quotizara verbrannte3
mitfhlen luisekissezbookslaura3
ist sie3
luisekissezbookslaura cardea3
cardea splitter3
splitter aus3
izara verbrannte3
dippel izara3
doch als3
damarisdykjulia dippel3
amsiert damarisdykjulia3
sogar amsiert3
dass sie3
als sie3
vor allem3
eis wow3
leserunden amp3
groartig ich3
reien kagaliamara3
zu lesen3
geschichte hat3
ksse geschichte3
die ksse3
amp so-falls3
fortsetzung zu3
vermisse fortsetzung3
dich vermisse3
amp so3
andeck wunder3
kagaliamara andeck3
zu reien3
anna-lenchenrena fischer3
spannender jugendthriller3
cryptos spannender3
poznanski cryptos3
felizelursula poznanski3
umgesetzt felizelursula3
fesselnd umgesetzt3
ein tolles3
dunkelheit ein3
der dunkelheit3
cursed die3
armentrout cursed3
besten bcher3
lesen anna-lenchenrena3
fischer elbendunkel3
year groartig3
blut kmpferisch3
grace year3
luisekissezbookskim liggett3
reihe luisekissezbookskim3
diese reihe3
schnes finale3
blutadels schnes3
3 lilien3
snow 33
readlovewriterose snow3
protagonisten readlovewriterose3
tolle protagonisten3
kmpferisch bildgewaltig3
wie blut3
elbendunkel 13
forna die3
marasbelovedbooksnamina forna3
charakteren marasbelovedbooksnamina3
tollen charakteren3
unglaublich sue3
you unglaublich3
skyline-of-booksmarisa kanter3
handlung skyline-of-booksmarisa3
temporeicher handlung3
jugendbuchtypische grundzge3
zurck jugendbuchtypische3
weg zurck3
ihrer familie3
die71
der71
sie56
ist42
zu38
mit34
von31
das27
ein26
als24
eine20
fr19
dem19
ihr19
geschichte16
hat16
amp16
so16
des16
ich16
es16
den15
auf13
aus13
mich12
buch12
nicht12
autorin11
aber11
sich11
ihrer11
wie10
bei10
einem10
ihre9
fuumlr9
sehr9
finale9
doch9
konnte8
um8
mehr8
lilien8
vor8
verbrannte8
wir7
dass7
snow7
wird7
wunder7
im7
blut7
auch7
erde7
ihrem6
otera6
besten6
bcher6
nur6
durch6
leben6
armentrout6
reihe6
hinter6
dritte6
liebe6
hoffnung6
bis5
einer5
adult5
berhrt5
er5
gttinnen5
diese5
oder5
menschen5
neue5
tolle5
sind5
ihren5
schreiben5
immer5
andeck5
kein5
dich5
fesselnd5
noch5
begeistert5
vom5
starken5
liegt5
05
l5
weg5
buumlcher5
berrascht4
definitiv4
poznanski4
klimadebatte4
magische4
vorne4
ember4
vr4
hinten4
zur4
dippel4
sogar4
teilweise4
fesselt4
gelungenes4
schockiert4
jugendthriller4
temporeicher4
toll4
episches4
mann4
top4
14
wurde4
muss4
new4
dann4
autorenmeistgelesene4
leser4
grandiose4
ins4
werden4
tolles4
ber4
hauptcharakter4
interessante4
viel4
grundzge4
vereint4
eis4
lesen4
blutadels4
falls4
silber4
so-falls4
gar4
bildgewaltig4
aufhren4
golden4
nach4
fischer4
luz4
forna4
tollen4
young4
sue4
like4
zurck4
alles4
leserunden4
lebt4
geboren4
grace4
bin4
durchgeflogen4
hauptprotagonistin4
mitfhlen4
cardea4
rose4
gefehlt4
bisschen4
hocker4
winzig4
steht3
unter3
gehen3
welt3
nash3
sein3
familie3
halle3
seitdem3
dabei3
lieben3
verlag3
schwester3
dort3
deutschen3
schon3
jugendliche3
allem3
erfolgreich3
wieder3
schreibt3
luisekissezbookskim3
ari3
fortsetzung3
unglaublich3
you3
kanter3
skyline-of-booksmarisa3
handlung3
jugendbuchtypische3
elbendunkel3
anna-lenchenrena3
ksse3
vermisse3
marasbelovedbooksnamina3
kagaliamara3
reien3
spannender3
cryptos3
felizelursula3
umgesetzt3
dunkelheit3
cursed3
buchkategorien3
charakteren3
kmpferisch3
mara3
izara3
york3
mdchen3
denn3
kommen3
wenn3
gerne3
lovelybooks3
roman3
quotizara3
damarisdykjulia3
protagonisten3
amsiert3
wow3
splitter3
luisekissezbookslaura3
groartig3
year3
liggett3
schnes3
23
readlovewriterose3
erebos3

Who hosts Lovelybooks.de?

Lovelybooks.de Hosting Provider Information

Hosted IP Address:136.243.41.28
Hosted Hostname:static.28.41.243.136.clients.your-server.de
Service Provider:Hetzner Online GmbH
Hosted Country:GermanyDE
Location Latitude:51.2993
Location Longitude:9.491
Webserver Software:Not Applicable

Is "Hetzner Online GmbH" in the Top 10 Hosting Companies?

Name
Percentage
GOOGLE
17.1842%
AS-26496-GO-DADDY-COM-LLC
4.0884%
NAMECHEAP-NET
3.5315%
GoDaddy.com, LLC
2.6631%
AMAZON-AES
2.5761%
UNIFIEDLAYER-AS-1
2.1530%
Fara Negar Pardaz Khuzestan
1.9418%
Unknown
1.8112%
1&1 Internet AG
1.6678%
CONFLUENCE-NETWORK-INC
1.6554%
Hetzner Online GmbH
0.5537%

HTTP Header Analysis for Lovelybooks.de

Http-Version: 1.1
Status-Code: 301
Status: 301 Moved Permanently
content-length: 0
location: https://www.lovelybooks.de/

Lovelybooks.de Domain Nameserver Information

HostIP AddressCountry
ns.udag.de 192.174.68.8
ns.udag.net 176.97.158.8
ns.udag.org 176.97.158.91


Need to find out who hosts Lovelybooks.de?


Domain Registration (WhoIs) information for Lovelybooks.de

 % Restricted rights.
%
% Terms and Conditions of Use
%
% The above data may only be used within the scope of technical or
% administrative necessities of Internet operation or to remedy legal
% problems.
% The use for other purposes, in particular for advertising, is not permitted.
%
% The DENIC whois service on port 43 doesn't disclose any information concerning
% the domain holder, general request and abuse contact.
% This information can be obtained through use of our web-based whois service
% available at the DENIC website:
% http://www.denic.de/en/domains/whois-service/web-whois.html
%
%

Domain: lovelybooks.de
Nserver: ns.udag.de
Nserver: ns.udag.net
Nserver: ns.udag.org
Status: connect
Changed: 2016-11-22T17:20:52+01:00

Websites with Similar Names

Lovel-f.com
秒速赛车_首页
Lovel.club
表白墙丨祝各位有情人终成眷属
Lovel.codes
lovel.codes - Registered at Namecheap.com
Lovel.com.tw
Lovel 愛生活 - 隨著Lovel享受愛的生活品味
Lovel.earth
Pocetna - Lovel Earth
Lovel.org
Free web hosting, free domain name, free domain hosting-LimeDomains
Lovel.tech
Registrant WHOIS contact information verification | Namecheap.com
Lovel4ce.com
Create an Ecommerce Website and Sell Online! Ecommerce Software by Shopify

Recently Updated Websites

Ontimegis.com (1 second ago.)86selake.com (3 seconds ago.)Wheatonmovingandstorage.com (3 seconds ago.)Lornazukas.com (4 seconds ago.)Gabrielleroque.com (4 seconds ago.)Dwscr.com (5 seconds ago.)Pearmoon.com (5 seconds ago.)Absth.com (5 seconds ago.)Verlasexpensas.com (6 seconds ago.)Carolslphome.com (7 seconds ago.)Naturfototage.org (7 seconds ago.)Brantparker.com (7 seconds ago.)Tjxiaoche.com (7 seconds ago.)Acompio.ca (7 seconds ago.)Blogging4novice.com (7 seconds ago.)Gabrielereichard.com (7 seconds ago.)Clubheadhunter.com (8 seconds ago.)Keypointenterprise.net (8 seconds ago.)Recoverycentersinc.org (8 seconds ago.)Jaylohr.com (8 seconds ago.)Thewelltn.com (10 seconds ago.)Steamunlock.org (10 seconds ago.)Selectharrison.com (10 seconds ago.)Chasingdreamguitars.com (10 seconds ago.)Vtdev.com (10 seconds ago.)Inverseiot.com (10 seconds ago.)50germans.com (10 seconds ago.)Construveritas.info (10 seconds ago.)Greekvanlines.com (10 seconds ago.)Lshcdlz.com (10 seconds ago.)

Recently Searched Keywords

derniers vus (1 second ago.)gazlı içecek (2 seconds ago.)insidious meaning (4 seconds ago.)contratos de trabajo (5 seconds ago.)baltimore, md (5 seconds ago.)lisa lewis instagram (6 seconds ago.)sex s dvojčaty (7 seconds ago.)wooden garage door repair (7 seconds ago.)implementasi mencintai (9 seconds ago.)eva收纳包 (9 seconds ago.)Angela white (10 seconds ago.)rongeurs (10 seconds ago.)perfume uae (12 seconds ago.)ass-60 (13 seconds ago.)hoogwaardige (13 seconds ago.)рыбы россии. справочник (13 seconds ago.)incredible meaning in english (15 seconds ago.)og vannskader (15 seconds ago.)host each (17 seconds ago.)wwe wrestling (17 seconds ago.)1000s of roots youtube (18 seconds ago.)blackberry delight w (19 seconds ago.)naviguent sur le (19 seconds ago.)reports 038 calculations (21 seconds ago.)jlpt n3 – intermediate (22 seconds ago.)auburn at jordan-hare (22 seconds ago.)купить удобрения и средства защиты растений (24 seconds ago.)автомобильный инструмент (24 seconds ago.)stralis - versiã³n corta (25 seconds ago.)retro canvasnew (25 seconds ago.)