Luxury Haven | Award-winning Singapore Lifestyle Blog

Safety: Low trust score
Year Founded: 2013
Global Traffic Rank: Unknown
Estimated Worth: $9

Luxury Haven is an Award-winning Lifestyle Blog by an ex-Flight Attendant. Beauty, Fashion, Food, Lifestyle, Travel, Giveaways; All-In-One!



Domain summary

Last updated
2020-10-26
Domain label
luxuryhaven
Domain extension
co
Domain registered:
2013-10-00
Domain updated:
2020-00-21
Domain expires:
2022-09-00
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Frequently Asked Questions (FAQ)

Q: When was Luxuryhaven.co registered?
A: Luxuryhaven.co was registered 7 years, 8 months, 2 weeks, 21 hours, 58 minutes, 57 seconds ago on Monday, September 30, 2013.
Q: When was the WHOIS for Luxuryhaven.co last updated?
A: The WHOIS entry was last updated 1 year, 5 months, 3 weeks, 3 days, 21 hours, 58 minutes, 57 seconds ago on Saturday, December 21, 2019.
Q: What are Luxuryhaven.co's nameservers?
A: DNS for Luxuryhaven.co is provided by the following nameservers:
  • ns67.domaincontrol.com
  • ns68.domaincontrol.com
Q: Who is the registrar for the Luxuryhaven.co domain?
A: The domain has been registered at .CO Internet, S.A.S..
Q: What is the traffic rank for Luxuryhaven.co?
A: Luxuryhaven.co has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Luxuryhaven.co each day?
A: Luxuryhaven.co receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Luxuryhaven.co resolve to?
A: Luxuryhaven.co resolves to the IPv4 address 216.239.36.21.
Q: In what country are Luxuryhaven.co servers located in?
A: Luxuryhaven.co has servers located in the United States.
Q: What webserver software does Luxuryhaven.co use?
A: Luxuryhaven.co is powered by GSE webserver.
Q: Who hosts Luxuryhaven.co?
A: Luxuryhaven.co is hosted by GOOGLE in California, Mountain View, United States, 94035.
Q: How much is Luxuryhaven.co worth?
A: Luxuryhaven.co has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Luxuryhaven.co Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Luxuryhaven.co Free SEO Report

Website Inpage Analysis for Luxuryhaven.co

H1 Headings

0 :

H2 Headings

35 :
  1. Luxury Haven Retiring From Blogging + Hello Kitty Giveaway!
  2. Blogging Break for Luxury Haven Lifestyle Blog
  3. Nam Nghi Phu Quoc, The Unbound Collection by Hyatt Officially Opens
  4. Keio Plaza Hotel Tama Opens My Melody, Little Twin Stars Rooms!
  5. 4 Tips To Spicing Up Your Hairdo
  6. OASE biOrb Tube Aquarium with LED Lighting Review
  7. Addictive Deep-Fried Wontons with Chives Recipe ( 韭菜鮮肉炸云吞 )
  8. World of Beauty Fascinating 3-Step Wonder Skin Beauty Routine
  9. Add Colours, Volume or Length with Hair Extensions at 30% Off!
  10. Adees Co: The Dream Collection Leather Goods For A Purpose
  11. S.S. Bon Voyage Sets Sail on Maiden Voyage through Bordeaux Region
  12. Luxury Leather Goods that Complete Your Look
  13. How to Start and Promote a Home Business Effectively
  14. Luxury Haven Pageviews
  15. 2020 Best Lifestyle Blogs in Singapore!
  16. Submit Your Food Shots to Win Liflicon Silicone Cookware Worth $400!
  17. Exclusive $38 Instead of $48 for 1st Visit @ R3vive Centres! Promo Code: LUXURYHAVEN
  18. Quote "LUXURY10" to Get Your Liflicon Silicone Cookware at 10% Off Storewide!
  19. 30% Off Your Organic Products at Forever Young Singapore!
  20. Quote "LUXURYHAVEN" to get 10% off EHA Skincare Products, & 20% Off Facials!
  21. 30% off All Hair Services at H4U Salon, Centrepoint! Show QR Code Below. *1st-timer Only!
  22. Get Your Special Follower 30% Off All Hair Services at H4U Salon!
  23. Translate This Page
  24. 2018 Best Luxury Lifestyle Website Award!
  25. Luxury Haven, Top 30 Singapore Lifestyle Bloggers to Follow in 2018!
  26. Ranked No. 5 in Top 75 Luxury Lifestyle Blogs 2017
  27. Search This Blog
  28. In The News
  29. Listed As 120 Most Inspiring Real Women for Int’l Women’s Day
  30. Featured in Nippon Paint's Islandwide Mailers
  31. Featured Post
  32. Topics
  33. Hot Topics
  34. Things I Write
  35. Random Posts

H3 Headings

1 :
  1. Travel Planner: How to Spend 5 Days in Melbourne, Victoria

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

108 :

Google Adsense

:
pub-7482348095381829

Google Analytics

:
UA-7368389-1

Links - Internal

109:

Links - Internal (nofollow)

0:

Links - Outbound

98:

Links - Outbound (nofollow)

52:

Keyword Cloud for Luxuryhaven.co

footer2hotel reviews staycationmanyhome businessblackswan thursday maydumplingsawardwinning singapore lifestylemondaytopunbound collectionblogfooter4candays8sidebarbottomfooter3namcontestsresortnextlifestyleblackswandobutwidgetmanagerregisterwidgetimageview newfoodupwidgetmanagerregisterwidgethtmlviewfirstfootertopreading labels diyiscurrentpage false href3aestheticsailsharemessageemailothersweevendisplaymodefull widgetmanagerregisterwidgetimageviewbeautycreatebrandskincareehaanyiscurrentpage falseworldoasehappyplazatwinsitesharemessage sharecodeensureblackswan monday maytipshrefthursdayqualityblogthisnotlookluxurymaydeepfriedfunctiondiy3stepspice upquocchivesawardwinning singaporebusinessgiftsbloggingcrispythursday mayoff all hairbiorbhaven awardwinning singaporeskinhair salon1asiaunboundnaturalproduct reviewscleansernohotel reviewssometextjavascriptup yourpurposefalse displaymodefullfood advertisementssooffhave beenfunction varkidsmuchmosttitle luxurykeytrulyresize true displaymodefullfollowinghttpswwwluxuryhavencoother readsoase biorbroutinehello kittyindulgence travelgiveawaysothermy blogvalfourhomeyoulabels diy tipsaddictive deepfried wontonscontinue reading labelsphutokyomaidenonlyhotel tamaluxury indulgence traveltaketitle luxury haven9placeafterwonderluxury indulgencevoyageenjoythesecomments blackswan mondaywidgetmanagerregisterwidgetimageview2productcaredisplaymodefull widgetmanagerregisterwidgetimageview newspicecontinuekeio plaza hotelnghi phu quocsaidluxury havenoneitsmadecomeresizeresize truegetplaza hotelfacebooksalon reviewswayssstaycation30 offaddictivetitlewindowcookieoptionsproductslabels diytherehavecoadees coshould14toseha skincarekittymorebraidscollection by hyattdatatraveldeepfried wontonsluxury haven awardwinningfashionfeatured5true displaymodefullhavenroomsonlinedocumentcreateelementscriptspecialdining reviewstoocomments blackswan thursday6importantcollection0greatall hair11hair extensionssingaporeindulgencereading labelsdisplaymodefull widgetmanagerregisterwidgethtmlview newextensionstamaveryworkamhelpbon voyage1012thosejusttitlex3dx22luxuryhavingaddictive deepfriedtrue displaymodefull widgetmanagerregisterwidgetimageviewgoingsharenghi phugoodsstartservicespopularrecipesshowmeallleather goodspromotionbeensincegoodnewcolourskeioreviewsnam nghi phubonpinterestlabelsawardwinningstylemysidebarasyncloaddesigncomments blackswanalsoidss bon voyagelifestyle blogtheynamehotelvarhyattnot onlyoff alllikeeventsss bonpromotion eventsdiy tipstitlex3dx22luxury haven awardwinning4linktheirlifesingapore lifestyle blogcommentsurlyourdifferenthelloadeesokmaiden voyageif youserumfalse hrefifwidgetmanagerregisterwidgethtmlview newcontinue readingappetizerssalonimportanceh4u salonclassich4unam nghiwontons with chiveswellnesstargetphu quocreadshervar sblackswan mondaymonday mayleatheronline shoppingiscurrentpageadvertisementscompletetitlex3dx22luxury havenreadingyour hairhair salon reviews7hotelsnghiplaza hotel tamadisplaymodefulllittle13shoppingcontests giveawaysdayaddhealthydisplaymodefull widgetmanagerregisterwidgethtmlviewhaven awardwinningwontonsfalsehasblackswan thursdaydiningtruereviews staycationwhilereturntimetwittergiveawaysingapore lifestyleopenskeio plazahairs

Longtail Keyword Density for Luxuryhaven.co

KeywordsOccurences
displaymodefull widgetmanagerregisterwidgethtmlview new26
displaymodefull widgetmanagerregisterwidgetimageview new14
continue reading labels13
resize true displaymodefull12
iscurrentpage false href11
true displaymodefull widgetmanagerregisterwidgetimageview8
award-winning singapore lifestyle7
haven award-winning singapore7
singapore lifestyle blog7
keio plaza hotel6
comments blackswan monday5
ss bon voyage5
blackswan monday may4
hotel reviews staycation4
hair salon reviews4
collection by hyatt4
nghi phu quoc4
nam nghi phu4
luxury haven award-winning4
blackswan thursday may4
comments blackswan thursday4
plaza hotel tama4
titlex3dx22luxury haven award-winning3
luxury indulgence travel3
title luxury haven3
off all hair3
wontons with chives3
labels diy tips3
reading labels diy3
addictive deep-fried wontons3
displaymodefull widgetmanagerregisterwidgethtmlview26
widgetmanagerregisterwidgethtmlview new26
luxury haven15
continue reading14
displaymodefull widgetmanagerregisterwidgetimageview14
widgetmanagerregisterwidgetimageview new14
reading labels13
comments blackswan12
true displaymodefull12
resize true12
lifestyle blog11
false href11
iscurrentpage false11
hello kitty8
product reviews8
singapore lifestyle8
diy tips7
haven award-winning7
award-winning singapore7
plaza hotel6
keio plaza6
luxury indulgence6
leather goods6
online shopping6
phu quoc6
my blog6
have been5
blackswan monday5
promotion events5
ss bon5
bon voyage5
eha skincare4
h4u salon4
adees co4
30 off4
hair extensions4
title luxury4
hotel tama4
if you4
salon reviews4
hair salon4
monday may4
reviews staycation4
hotel reviews4
unbound collection4
nghi phu4
nam nghi4
thursday may4
blackswan thursday4
dining reviews4
false displaymodefull3
sharemessage share3
titlex3dx22luxury haven3
var s3
function var3
all hair3
off all3
food advertisements3
other reads3
home business3
not only3
maiden voyage3
deep-fried wontons3
addictive deep-fried3
labels diy3
your hair3
spice up3
up your3
contests giveaways3
indulgence travel3
oase biorb3
new57
displaymodefull52
false35
your30
true28
you27
widgetmanagerregisterwidgethtmlview26
luxury26
sidebar23
my22
blog21
hair21
reviews20
haven18
name18
lifestyle17
title16
var15
continue15
may15
reading14
comments14
014
hotel14
widgetmanagerregisterwidgetimageview14
resize14
blackswan13
labels13
function13
iscurrentpage12
href12
id12
singapore11
all11
but11
skin11
tips11
home11
skincare10
so10
beauty10
can10
url10
blogging10
me10
have10
fashion9
some9
off9
leather9
food9
travel9
award-winning9
its9
collection9
product9
voyage8
online8
facebook8
kitty8
salon8
their8
if8
rooms8
more8
hello8
18
up7
get7
been7
diy7
goods7
hyatt7
take7
giveaways7
chives7
27
these7
37
not7
events7
plaza6
quoc6
help6
keio6
world6
phu6
indulgence6
good6
target6
sharemessage6
key6
products6
httpswwwluxuryhavenco6
recipes6
shopping6
only5
ss5
footer35
promotion5
dining5
any5
important5
like5
data5
ensure5
link5
do5
bon5
wontons5
colours5
footer45
45
natural5
since5
start5
design5
services5
share5
come5
too5
tama5
tokyo5
other5
most5
co5
monday5
business4
code4
aesthetic4
following4
four4
quality4
purpose4
made4
adees4
eha4
h4u4
extensions4
days4
thursday4
many4
little4
tos4
54
pinterest4
footer-top4
sidebar-bottom4
documentcreateelementscript4
textjavascript4
has4
am4
email4
twitter4
64
much4
those4
74
windowcookieoptions4
nghi4
84
94
nam4
one4
unbound4
asia4
said4
day4
look4
they4
way4
biorb4
braids4
add4
staycation4
104
style4
deep-fried4
brand4
we4
first4
hotels4
next4
very4
kids4
114
place3
asyncload3
having3
even3
time3
footer23
s3
featured3
top3
contests3
twin3
spice3
care3
ok3
there3
titlex3dx22luxury3
show3
healthy3
great3
going3
while3
val3
blogthis3
different3
create3
after3
123
advertisements3
serum3
enjoy3
addictive3
resort3
special3
return3
happy3
133
cleanser3
life3
just3
crispy3
dumplings3
should3
routine3
3-step3
opens3
work3
importance3
reads3
oase3
popular3
appetizers3
classic3
no3
complete3
143
wellness3
giveaway3
truly3
maiden3
sail3
site3
wonder3
also3
her3
gifts3
others3

Who hosts Luxuryhaven.co?

Luxuryhaven.co Hosting Provider Information

Hosted IP Address:216.239.36.21
Hosted Hostname:any-in-2415.1e100.net
Service Provider:GOOGLE
Hosted Country:United StatesUS
Location Latitude:37.3891
Location Longitude:-122.0867
Webserver Software:GSE

Is "GOOGLE" in the Top 10 Hosting Companies?

Name
Percentage
GOOGLE
17.1842%
AS-26496-GO-DADDY-COM-LLC
4.0884%
NAMECHEAP-NET
3.5315%
GoDaddy.com, LLC
2.6631%
AMAZON-AES
2.5761%
UNIFIEDLAYER-AS-1
2.1530%
Fara Negar Pardaz Khuzestan
1.9418%
Unknown
1.8112%
1&1 Internet AG
1.6678%
CONFLUENCE-NETWORK-INC
1.6554%

HTTP Header Analysis for Luxuryhaven.co

Http-Version: 1.1
Status-Code: 301
Status: 301 Moved Permanently
Location: https://www.luxuryhaven.co/
Content-Type: text/html; charset=UTF-8
Content-Encoding: gzip
Date: Mon, 26 Oct 2020 03:56:31 GMT
Expires: Mon, 26 Oct 2020 03:56:31 GMT
Cache-Control: private, max-age=0
X-Content-Type-Options: nosniff
X-Frame-Options: SAMEORIGIN
Content-Security-Policy: frame-ancestors 'self'
X-XSS-Protection: 1; mode=block
Content-Length: 175
Server: GSE

Luxuryhaven.co Domain Nameserver Information

HostIP AddressCountry
ns67.domaincontrol.com 97.74.103.44
ns68.domaincontrol.com 173.201.71.44


Need to find out who hosts Luxuryhaven.co?


Domain Registration (WhoIs) information for Luxuryhaven.co

 Domain Name: luxuryhaven.co
Registry Domain ID: D46031027-CO
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: whois.godaddy.com
Updated Date: 2020-06-21T12:00:12Z
Creation Date: 2013-07-10T15:31:47Z
Registry Expiry Date: 2022-07-09T23:59:59Z
Registrar: GoDaddy.com, Inc.
Registrar IANA ID: 146
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.4806242505
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited
Registry Registrant ID:
Registrant Name:
Registrant Organization: Domains By Proxy, LLC
Registrant Street:
Registrant Street:
Registrant Street:
Registrant City:
Registrant State/Province: Arizona
Registrant Postal Code:
Registrant Country: US
Registrant Phone:
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Tech contact of the queried domain name.
Registry Admin ID:
Admin Name:
Admin Organization:
Admin Street:
Admin Street:
Admin Street:
Admin City:
Admin State/Province:
Admin Postal Code:
Admin Country:
Admin Phone:
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Tech contact of the queried domain name.
Registry Tech ID:
Tech Name:
Tech Organization:
Tech Street:
Tech Street:
Tech Street:
Tech City:
Tech State/Province:
Tech Postal Code:
Tech Country:
Tech Phone:
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Tech contact of the queried domain name.
Name Server: ns68.domaincontrol.com
Name Server: ns67.domaincontrol.com
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of WHOIS database: 2020-06-26T06:50:02Z

Websites with Similar Names

Luxur-tv.com
luxur-tv.com
Luxur.com.ua
Парковая страница Imena.UA
Luxur.lighting
luxur.lighting
Luxur.travel
Luxur Travel – Agencia de Viajes
Luxura-debrecen.hu
Szépségszalon Debrecen-Luxura szépségszalon Debrecenben a Fórumban

Recently Updated Websites

Muddcam.photos (4 seconds ago.)Aetnamedichare.com (4 seconds ago.)Shadesofwhite-muc.com (5 seconds ago.)Smartbuyenterprises.com (5 seconds ago.)Hygkyy.com (5 seconds ago.)Ukgatsos.com (5 seconds ago.)Starzlimousineservices.com (6 seconds ago.)Cv-sedanstrasse.de (6 seconds ago.)Chainultra.com (8 seconds ago.)Lollipophaircutshop.com (8 seconds ago.)Commonmarkethealth.com (8 seconds ago.)Trainsandsuch.com (8 seconds ago.)Edenetechnologysolutions.com (9 seconds ago.)Maishaneema.org (9 seconds ago.)Vamcer.icu (9 seconds ago.)Kranfiks.com (10 seconds ago.)Bsr72j8ss4.work (11 seconds ago.)Independentvoyager.com (12 seconds ago.)Alexshop4.xyz (12 seconds ago.)Neanchorsrugby.com (14 seconds ago.)Bigfrognb.com (14 seconds ago.)Keyaedu.com (15 seconds ago.)Thebackfires.com (16 seconds ago.)Orangezine.com (16 seconds ago.)Troyvrealestate.com (16 seconds ago.)Clayart-jasmine.com (18 seconds ago.)Themiddleclasser.org (18 seconds ago.)Ibroom.in (18 seconds ago.)Ghealthmarkets.com (18 seconds ago.)Rootedlearningcenter.org (19 seconds ago.)

Recently Searched Keywords

тимчасова реєстрація місця проживання 2019 (1 second ago.)sponsorship prospectus (2 seconds ago.)ornate floral pitcher subeta (2 seconds ago.)машина ест машину: подземное приключение (5 seconds ago.)créneaux (6 seconds ago.)download our capabilities deck (7 seconds ago.)συγγράμματα πανεπιστημίων (8 seconds ago.)hkjc membership directory (8 seconds ago.)letter-spacing2px (9 seconds ago.)■ (有)榮屋 (9 seconds ago.)ولا (12 seconds ago.)bisogno delle tue mani (12 seconds ago.)rygbuh64 (15 seconds ago.)27 illaweena street drewvale (16 seconds ago.)elementor-1125 (21 seconds ago.)concerning clickfunnels (23 seconds ago.)bkmteknik (23 seconds ago.)where are my glasses where oh where (24 seconds ago.)zinc (24 seconds ago.)standardbank (28 seconds ago.)пес 5 сезон 15 серия ютуб (33 seconds ago.)tiotar (37 seconds ago.)harley benton acoustic review (40 seconds ago.)baseline assessment meaning in hindi (42 seconds ago.)_demo_test.htm (44 seconds ago.)_demo_test.htm (44 seconds ago.)tommilee.ru (46 seconds ago.)facebook profile cover image size (47 seconds ago.)ð ð°ð»ð»ð¸ (50 seconds ago.)zajcia zwikszajce (54 seconds ago.)