mem

Safety: Low trust score
Year Founded: 2012
Global Traffic Rank: Unknown
Estimated Worth: $9
Last updated:2020-10-17
Category: This site has not been categorized yet

designer / artdirector kenji maeda


Domain summary

Domain label
m-e-m
Domain extension
jp
Domain registered:
2012-04-29
Domain updated:
2020-05-01
Domain expires:
2021-04-30
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is m-e-m.jp ranked relative to other sites:

Percentage of visits to m-e-m.jp from a search engine:


Frequently Asked Questions (FAQ)

Q: When was M-e-m.jp registered?
A: M-e-m.jp was registered 8 years, 8 months, 2 weeks, 3 days, 11 hours, 23 minutes, 43 seconds ago on Sunday, April 29, 2012.
Q: When was the WHOIS for M-e-m.jp last updated?
A: The WHOIS entry was last updated 8 months, 2 weeks, 1 day, 11 hours, 23 minutes, 43 seconds ago on Friday, May 1, 2020.
Q: What are M-e-m.jp's nameservers?
A: DNS for M-e-m.jp is provided by the following nameservers:
  • ns1.xserver.jp
  • ns2.xserver.jp
  • ns3.xserver.jp
  • ns4.xserver.jp
  • ns5.xserver.jp
Q: Who is the registrar for the M-e-m.jp domain?
A: The domain has been registered at Japan Registry Services.
Q: What is the traffic rank for M-e-m.jp?
A: M-e-m.jp has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit M-e-m.jp each day?
A: M-e-m.jp receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does M-e-m.jp resolve to?
A: M-e-m.jp resolves to the IPv4 address 198.185.159.135.
Q: In what country are M-e-m.jp servers located in?
A: M-e-m.jp has servers located in the United States.
Q: What webserver software does M-e-m.jp use?
A: M-e-m.jp is powered by Squarespace webserver.
Q: Who hosts M-e-m.jp?
A: M-e-m.jp is hosted by Squarespace, Inc. in New York, New York, United States, 10013.
Q: How much is M-e-m.jp worth?
A: M-e-m.jp has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

M-e-m.jp Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

M-e-m.jp Free SEO Report

Website Related Search Terms

Website Inpage Analysis for M-e-m.jp

H1 Headings

0 :

H2 Headings

0 :

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

1 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-49389778-1

Links - Internal (nofollow)

0:

Links - Outbound

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for M-e-m.jp

sqsslidecontainerdataslidetypepopupoverlayoverlayalignmentcentersocialstackedtextalignleft dataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpagedataslicetypealbum iconwrapperlastchildmarginright0sqsslidewrapperdataslidetypecoverpagesqsslicecustomform asqsslidewrapperdataslidetypecoverpageuseiconfillfffsqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconslightboxcontent formwrapper pcountdowncontentdataformatnumericdisplaytablesqsslidewrapperdataslidetypecoverpagesqsslicecustomformdataslicetypesocialicons youtubevevodataslicetypesocialiconshover emailhoverdataslicetypesocialiconshover codependataslicetypebuttonssqsslidewrapperdataslidetypecoverpagesocialiconscolorstandardsocialiconsstyleregular dataslicetypesocialiconsdataslicetypesocialicons dribbblethedotshoverresponsivewrapperstackeddataslicetypealbum sqsslicealbumplaylisttwitchhoverstumbleuponformwrapper inputtypesubmitsqsslidewrapperdataslidetypecoverpage buttonstyleoutlinedataslicetypesocialiconshover rsshoversocialiconssizeextralargesocialiconsstyleborder2s easesqsslidewrapperdataslidetypecoverpagesqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinline actionsstacked inputwrapperuseiconfill222sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleborder dataslicetypesocialiconsdataslicetypemaptweetavatarsvgsocialwebkittransitionbackgroundcolor 170ms easeinoutmoztransitionbackgroundcolor1px0sqsslidewrapperdataslidetypecoverpagebordercolor 170ms easeinoutsqsslidewrapperdataslidetypecoverpagedataslicetypesocialicons codepentweetdisplaynameeaseinoutotransitionbackgroundcolor 170msinputtypesubmithoversqsslidewrapperdataslidetypecoverpageuseiconfillf60sqsslidewrapperdataslidetypecoverpageeaseinouttransitionbackgroundcolor 170mssqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstylestacked inputwrappertracktitlesqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabledbuttonstyleraisedcodepentracks trackuseiconfillcc2127sqsslidewrapperdataslidetypecoverpageliinputtypepasswordmozplaceholdercolorfffsqsslidewrapperdataslidetypecoverpagehouzzhoverdataslicetypesocialiconshover twitchhoverdataslicetypesocialiconshover tidalhoverdataslicetypesocialiconshover soundcloudhoversocialiconssizeextralargesocialiconsstyleregularuseiconfill382110sqsslidewrapperdataslidetypecoverpageimportantsqsslidewrapperdataslidetypecoverpage sqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinlinedataslicetypesocialiconshover thedotsdataslicetypesocialiconshover stumbleupondataslicetypenavigation ulautoflex1dataslicetypesocialiconshover flickrdataslicetypenavigationsqsslidewrapperdataslidetypecoverpage dataslicetypecountdown countdowncontentdataformatnumericdataslicetypeheadingnotdatacompoundtypedataslicetypetwitternotdatacompoundtypedataslicetypebuttons li ahoversqsslidewrapperdataslidetypecoverpageuseiconfill7dbb00sqsslidewrapperdataslidetypecoverpagesqsslidecontainerdataslidetypepopupoverlaynewsletterstyleoutline datacompoundtypepopupoverlayactionsquarespacesqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinline actionsstackedautosqsslidewrapperdataslidetypecoverpageeaseinoutsqsslidewrapperdataslidetypecoverpagesocialiconssizeextrasmallsocialiconsstyleregularcountdowncontentdataformattextual countdownunitusemaskfill222sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleknockoutthedotsdataslicetypemap gmstyleccdataslicetypebuttons ulsqsslidewrapperdataslidetypecoverpageahoversqsslidewrapperdataslidetypecoverpagescreensocialiconscolorstandardsocialiconsstyleknockout dataslicetypesocialiconsulstackedcountdownunitsocialiconsstyleborder dataslicetypesocialiconssqsmodallightboxopenuseiconfillfffsqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconshoverdataslicetypesocialiconshover githubdataslicetypesocialicons vimeodataslicetypesocialicons usemaskfilltransparentsqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover houzzhoverdataslicetypesocialiconshover bandsintownhoverstitcherhoversqsslidecontainerdataslidetypepopupoverlaybuttonlayoutstyleinlineautoiconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizesmallsocialiconsstylesolidyelphoverspotifysqsslidecontainerdataslidetypepopupoverlaybuttonlayoutstyleautodataslicetypesocialicons facebookuseiconfill1769ffsqsslidewrapperdataslidetypecoverpageuseiconfill222sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleregulardataslicetypesocialiconshover codepenhovermediumuseiconfilldc4e41sqsslidewrapperdataslidetypecoverpageusemaskfill222sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleknockout dataslicetypesocialiconshoversqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabledbuttonstyleoutline datacompoundtypepopupoverlayactiondataslicetypesocialicons linkedinulsqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover yelphoversqsslidecontainerdataslidetypepopupoverlaynewsletterstyleunderlined datacompoundtypepopupoverlayactionvinehoveralldataslicetypealbum sqsslicealbumplaylistdemoalbummapstyleminimaldark2s 2sdataslicetypesocialicons imdbsqsslidecontainerdataslidetypepopupoverlaynewsletterstylerectanglesocialiconsstyleknockout dataslicetypesocialiconsdataslicetypesocialiconshover snapchathoveruseiconfill007ee5sqsslidewrapperdataslidetypecoverpagesqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabledbuttonstyleoutline dataslicetypebuttonsusemaskfilltransparentsqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover rdiohoverdataslicetypesocialiconshover squarespace3pxdataslicetypesocialicons googledataslicetypesocialicons instagramdropboxdataslicetypesocialiconshover meetupsocialiconsstylesolid dataslicetypesocialiconshoversqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstylestackeddataslicetypealbumhover iconwrappersqsslidelayercontentneuearialsansseriffontweight700fontstylenormalfontsize16pxtexttransformnoneletterspacing01emsqsslidewrapperdataslidetypecoverpagedataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizeextrasmallsocialiconsstylesolidiconwrapperwidth24pxheight24pxmargin0useiconfillrgba2552552554sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconshoveryoutubedataslicetypesocialiconshover emaileaseinoutmstransitionbackgroundcolor 170ms easeinoutotransitionbackgroundcolor14pxsqsmodallightboxdribbblehoverbuttonstyleoutline sqsslicecustomformdataslicetypealbum iconwrapperlastchildsqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover rdio0pxsqsslicealbumplaylist trackssocialiconscolorstandardsocialiconsstyleregular dataslicetypesocialiconshoverusebackgroundfillfffsqsslidewrapperdataslidetypecoverpagesqsmodallightboxcontent lightboxinnerlinkedinshowtracktitle sqsalbumminimal dataslicetypealbumdataslicetypesocialiconshover rssdataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizemediumsocialiconsstylesoliduseiconfillrgba3434344sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleregularsmugmughovericonwrappersqsslidewrapperdataslidetypecoverpage socialiconssizemediumsocialiconsstyleknockoutactionssqsslidewrapperdataslidetypecoverpagetweetbodydataslicetypesocialiconshover smugmugsocialiconscolorstandardsocialiconsstyleborder dataslicetypesocialiconsdataslicetypesocialiconshover githubhoveraudioplayericonsstyleregulardataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpagedataslicetypesocialicons twitchuseiconfill006ed2sqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover googleplayhovereaseinoutmoztransitionbackgroundcolor 170ms easeinoutmstransitionbackgroundcoloradisplayblocksqsslidewrapperdataslidetypecoverpageemailhoverdataslicetypealbumeaseinoutotransitionbackgroundcolor 170ms easeinouttransitionbackgroundcolordataslicetypegallerysqsgallerygridresponsivewrapperstacked dataslicetypenavigation ulusemaskfill222sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconsiconwrapperdivwebkittransformscale2moztransformscale2mstransformscale2transformscale2sqsslidewrapperdataslidetypecoverpagedataslicetypesocialicons githublockstyleknockout dataslicetypelockdataslicetypesocialicons tidalgoodreadsdataslicetypesocialiconshover vinehoveravisitedsqsslidewrapperdataslidetypecoverpagedataslicetypesocialicons soundcloudgooglehoverdataslicetypesocialicons stumbleupondataslicetypemap gmnoprintinputtypetextmozplaceholdercolorrgba1631631635sqsslidewrapperdataslidetypecoverpagesocialiconsstylesolid dataslicetypesocialiconshover iconwrapperhoverbuttonshapepillsqsslidecontainerdataslidetypepopupoverlaynewsletterstylerectangle datacompoundtypepopupoverlayactionbandsintownasqsslidewrapperdataslidetypecoverpagesqsslicecustomformsqsslidewrapperdataslidetypecoverpagesqsalbumminimaldataslicetypegallery galleryvideobackgroundmobiledataslicetypesocialicons rssiconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizelargesocialiconsstylesolidtumblrhoversqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabledbuttonstyleoutline dataslicetypebuttons lisocialiconscolorstandardsocialiconsstyleknockout2emuseiconfillfffsqsslidewrapperdataslidetypecoverpagedataslicetypebuttons ul lisqsslidewrapperdataslidetypecoverpagedatacompoundtypepopupoverlayaction inputtypetextmozplaceholdercolorrgba1631631635sqsslidewrapperdataslidetypecoverpagedataslicetypetwittersocialiconssizeextrasmallsocialiconsstylesoliduseiconfille52d27sqsslidewrapperdataslidetypecoverpagebuttonstylesoliduseiconfillf94877sqsslidewrapperdataslidetypecoverpagesqsslidecontainerdataslidetypepopupoverlay datacompoundtypepopupoverlayactionfacebookhoversqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinlineinstagramhover01suseiconfill6441a5sqsslidewrapperdataslidetypecoverpageformwrapper inputtypesubmithoversqsslidewrapperdataslidetypecoverpagesocialiconssizesmallsocialiconsstyleregularhouzzdataslicetypesocialiconshover mediumhoverdataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizeextralargesocialiconsstylesoliddataslicetypesocialiconshover goodreadshoverformitemsqsslidewrapperdataslidetypecoverpagesolidsqsslidecontainerdataslidetypepopupoverlayenableoverlaycontentborderpinterestsocialiconsstyleregular dataslicetypesocialiconsuseiconfill7ac143sqsslidewrapperdataslidetypecoverpageapplepodcastsocialiconssizelargesocialiconsstyleknockoutdataslicetypecountdown countdowncontentdataformattextualdataslicetypesocialiconshover bandsintowndataslicetypesocialicons stitcherneuearialsansseriffontweight400fontstylenormalletterspacing6pxsqsslidewrapperdataslidetypecoverpage2s easeintransitionopacity 2seaseintransitionopacity 2sdisclaimercontainersqsslidewrapperdataslidetypecoverpagemeetupeaseinoutmoztransitioncolordataslicetypealbum iconwrappersqsslidewrapperdataslidetypecoverpagedataslicetypesocialicons meetupuseiconfill35465dsqsslidewrapperdataslidetypecoverpageeaseinmoztransitionopacityinputwrapperdataslicetypesocialicons vinevimeohoveruseiconfillfffsqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleknockoutlisqsslidewrapperdataslidetypecoverpage5pxsqsslicealbumplaylistdataslicetypetwitternotdatacompoundtype tweettimestampsnapchathoveruseiconfillff0031sqsslidewrapperdataslidetypecoverpagesqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinline actionsnotstacked inputwrappernothiddensqsalbumminimal dataslicetypealbumsnapchateaseinout bordercolormeetuphoverdataslicetypesocialiconshover tidaluseiconfill222backgroundcolor222sqsslidewrapperdataslidetypecoverpageiconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizeextrasmallsocialiconsstylesoliddataslicetypesocialiconshover dribbbleptumblrsvgsocialbackgroundcolor222sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleregular dataslicetypesocialiconsvideoiconstyleregulardataslicetypesocialiconshover stitchersqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinline actionsstacked inputwrappernothiddendataslicetypesocialiconshover twitterlightboxinner lightboxcontent formwrapperdataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizesmallsocialiconsstyleknockoutdataslicetypesocialiconshover applepodcasthoverdataslicetypesocialiconshover linkedininstagramdataslicetypesocialicons vevoaudioplayericonsstyleregular dataslicetypealbumdataslicetypesocialiconshover instagramdataslicetypesocialiconshover youtubedataslicetypesocialicons yelpaudioplayericonsstyleborder dataslicetypealbumsqsslidewrapperdataslidetypecoverpage dataslicetypecountdownsqsslicecustomform ahoversqsslidewrapperdataslidetypecoverpagegithubhovereaseinoutmoztransitionbackgroundcolorinputtypetextsqsslidewrapperdataslidetypecoverpagesvgsocialbackgroundcolor222sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleregulareaseinoutmoztransitionbackgroundcolor 170mslightboxcontentdataslicetypealbum sqsslicealbumplayliststackeduseiconfillrgba3434344sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleregular dataslicetypesocialiconshoveruseiconfill00ab6csqsslidewrapperdataslidetypecoverpagesvgsocialwebkittransitionbackgroundcolor 170msdataslicetypesocialiconshover imdbhoversocialiconssizesmallsocialiconsstylebordertwitterhovervideoiconstylesoliddataslicetypetwitternotdatacompoundtype tweetbodyonlyusemaskfillrgba3434344sqsslidewrapperdataslidetypecoverpageeaseinmoztransitionopacity 2salignmentcentertrackprogressbaruseiconfillc41200sqsslidewrapperdataslidetypecoverpagegoogleplayactionsnotstacked inputwrappernothiddenbuttonstyleoutlinesqsmodallightbox formwrapperdataslicetypegallery galleryvideobackgroundsocialiconscolorstandardsocialiconsstyleknockout dataslicetypesocialiconshoverpasswordstylerectanglebuttonstyleoutlinesqsmodallightbox formwrapper inputtypesubmitsqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover vimeobuttonstyleraiseddataslicetypesocialicons behanceuseiconfilleb4924sqsslidewrapperdataslidetypecoverpagesocialiconssizeextrasmallsocialiconsstyleborderdataslicetypesocialiconshover soundcloudalignmentcenter responsivewrapperstackediconwrapperhoversqsslidecontainerdataslidetypepopupoverlayall and maxwidth600pxsqsslidewrapperdataslidetypecoverpagelockstyleborder dataslicetypelocklockstyleregular dataslicetypelockuseiconfill5adfcbsqsslidewrapperdataslidetypecoverpageeaseinoutsqsslidewrapperdataslidetypecoverpage socialiconsstylesoliduseiconfillff4500sqsslidewrapperdataslidetypecoverpagesqsslidecontainerdataslidetypepopupoverlaybuttonlayoutstyleauto dataslicetypebuttonstweettimestamp8pxdataslicetypesocialiconshover snapchatsqsslidewrapperdataslidetypecoverpage responsivewrappernotstackeduseiconfille4405fsqsslidewrapperdataslidetypecoverpageuseiconfill1ea9e1sqsslidewrapperdataslidetypecoverpagevimeosqsslicedatacontentemptytruedisplaynonesqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover pinterestdataslicetypesocialicons dropboxlockstyleknockoutdataslicetypesocialiconshover twitchdataslicetypesocialiconshover googlehoverdataslicetypebody pstumbleuponhoversqsmodallightboxcontentuseiconfillrgba2552552554sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstylesoliddataslicetypesocialiconshover squarespacehoverbehancehovericonwrapperwidth32pxheight32pxmargin0gmstyleccsqsslidesqsslideanimationreadydataslicetypepassworduseiconfill222sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleborder0ms 0msuseiconfill4183c4sqsslidewrapperdataslidetypecoverpagevscohoverdataslicetypesocialiconshover mediumdataslicetypesocialiconshover fivehundredpixtwitterul lisqsslidewrapperdataslidetypecoverpagefielderrordisplayblockpositionabsoluteboxsizingborderboxpadding25em 5emfont14pxactionsstacked inputwrappernothiddendataslicetypesocialiconshover facebookreddithoverdataslicetypesocialicons spotifysqsslidecontainerdataslidetypepopupoverlay captchacontainerwrapperdropboxhoverimdbpasswordstyleunderlinedsocialiconsstylesolid dataslicetypesocialiconshover iconwrapper170ms easeinoutmstransitionbackgroundcolor 170mssqsslidecontainerdataslidetypepopupoverlayoverlayloadanimationslideinbuttonstyleoutlinesqsmodallightboxdataslicetypesocialiconshover reddithoveruseiconfill1ab7easqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover tumblrdataslicetypesocialicons flickrp asqsslidewrapperdataslidetypecoverpageonly screendataslicetypesocialiconshover pinteresthoveruseiconfill0099e5sqsslidewrapperdataslidetypecoverpage170ms easeoutopacity2s easeinmoztransitionopacity 2ssqssliceplaybuttoniconwrapperinputtypesubmitsqsslidewrapperdataslidetypecoverpage buttonstyleoutlinesvgsocialbackgroundcolor222sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstylesoliduseiconfill222sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleregular dataslicetypesocialiconshoverusebackgroundfilltransparentsqsslidewrapperdataslidetypecoverpagesocialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconshoverdataslicetypesocialiconshover imdblightboxinnerdataslicetypesocialiconshover iconwrapperhovereaseinouttransitionbackgroundcolor 170ms easeinoutsqsslidewrapperdataslidetypecoverpagersssqsslidecontainerdataslidetypepopupoverlayoverlayalignmentleftdatacompoundtypepopupoverlayaction buttontypesubmitsqsslidewrapperdataslidetypecoverpageituneshovereaseinmstransitionopacity 2sdataslicetypebuttons li asqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover smugmughoverfielderrordisplayblockpositionabsoluteboxsizingborderboxpadding25em170ms easeinoutmoztransitionbackgroundcolor 170msdataslicetypesocialicons smugmugresponsivewrapperstacked dataslicetypebuttonsdataslicetypesocialiconshover youtubehover170ms easeinoutmstransitionbackgroundcoloruseiconfilltransparentsqsslidewrapperdataslidetypecoverpage2s easeintransitionopacitydataslicetypealbum sqsslicealbumplaylist trackseaseinoutotransitioncolorsvgsocialbackgroundcolor222sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconshover1dataslicetypesocialicons emaildataslicetypesocialiconshover vevocaptchacontainerwrappersocialiconscolorstandardsocialiconsstyleborderdataslicetypesocialicons tumblractionsstackeddataslicetypesocialicons houzzsocialiconssizemediumsocialiconsstyleregularresponsivewrapperstacked dataslicetypenavigationdataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizesmallsocialiconsstylesolidsqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabledbuttonstyleoutlinesocialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconssqsslicealbumplaylistdemoalbumdataslicetypesocialiconshover thedotshovereaseinoutmstransitionbackgroundcolordataslicetypesocialiconslayerfront sqsslidelayercontentdataslicetypecountdowndataslicetypebuttons lisqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover linkedinhoverdataslicetypesocialiconshover googlefivehundredpixdataslicetypesocialiconshover dropboxdataslicetypepassword inputtypepasswordmozplaceholdercolorfffsqsslidewrapperdataslidetypecoverpagedataslicetypenavigation ul lisqsslicealbumplayliststackedemailvscouseiconfillfffsqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleknockout dataslicetypesocialiconsfacebookiconwrapperlastchildsqsslidewrapperdataslidetypecoverpagesocialiconssizelargesocialiconsstyleborderdataslicetypesocialiconshover twitterhoversqsslidewrapperdataslidetypecoverpageresponsivewrapperdataslicetypesocialiconshover meetuphoverbuttonstyleoutline datacompoundtypepopupoverlayactionrdiohovershowtracktitle sqsalbumminimalimdbhoversqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabled datacompoundtypepopupoverlayactionlockstylesolidul li asqsslidewrapperdataslidetypecoverpagesqsalbumminimal dataslicetypealbum sqsslicealbumplaylistdemoalbumsocialstackedinputwrappernothiddenbuttonshaperoundedcorners170ms easeinoutsqsslidewrapperdataslidetypecoverpage170ms easeinouttransitionbackgroundcolor 170ms2s easeinmstransitionopacitysocialiconsstylesoliddataslicetypesocialiconshover foursquarehoverdataslicetypesocialiconshover stumbleuponhoversqsmodallightboxcontent lightboxinner lightboxcontent2em 0px 0pxiconwrappersqsslidewrapperdataslidetypecoverpagedataslicetypegallerydataslicetypesocialiconshover googleplaysocialiconssizelargesocialiconsstylesolidli asqsslidewrapperdataslidetypecoverpagedataslicetypecountdown countdowncontentdataformattextual countdownuniteaseinouttransitioncolordataslicetypesocialiconshover vscohoversqsslidecontainerdataslidetypepopupoverlaynewsletterstyleunderlineddataslicetypealbum sqsslicealbumplaylistplayingdataslicetypealbumhover4pxbehanceuseiconfillrgba2552552554sqsslidewrapperdataslidetypecoverpage170ms easeinouttransitionbackgroundcolordataslicetypesocialicons twitteruseiconfill8c8070sqsslidewrapperdataslidetypecoverpagesmugmuginputtypepasswordsqsslidewrapperdataslidetypecoverpage10pxsqsslicecustomform spansqsslidewrapperdataslidetypecoverpagesqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabled dataslicetypebodydataslicetypecountdown countdowncontentdataformatnumericeaseinout bordercolor 170ms7pxdatacompoundtypepopupoverlayaction errormessagesqsslidewrapperdataslidetypecoverpageusemaskfill222sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstylesolidactionsnotstackedeaseoutopacityasqsslidewrapperdataslidetypecoverpage buttonstyleoutline2em 0pxresponsivewrapperstacked dataslicetypebuttons ulsqsslidewrapperdataslidetypecoverpageyelpsoundcloudhoversqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabled dataslicetypebody puseiconfillrgba3434344sqsslidewrapperdataslidetypecoverpagesqssliceplaybuttoniconwrapperhoversocialiconssizeextralargesocialiconsstyleknockoutasqsslidewrapperdataslidetypecoverpage buttonstyleoutline sqsslicecustomformuseiconfillec4652sqsslidewrapperdataslidetypecoverpagebuttonstyleoutline dataslicetypebuttonsformwrappericonwrappersqsslidewrapperdataslidetypecoverpage socialiconssizeextrasmallsocialiconsstyleknockouticonwrapperwidth28pxheight28pxmargin0170ms easeinoutmoztransitionbackgroundcolorfffsqsslidewrapperdataslidetypecoverpagepinteresthoverscreen and maxwidth600pxsqsslidewrapperdataslidetypecoverpagesocialstacked dataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpagesvgsocialbackgroundcolortransparentsqsslidewrapperdataslidetypecoverpagedataslicetypesocialicons bandsintownuseiconfille0393esqsslidewrapperdataslidetypecoverpagecountdowncontentdataformattextual170mssocialstackedtextalignleftdataslicetypepassword arrowiconeaseinmstransitionopacity5emfont14px0useiconfill0976b4sqsslidewrapperdataslidetypecoverpageeaseinoutotransitionbackgroundcoloralignmentrightredditdataslicetypealbumhover iconwrapperhovericonwrappersqsslidewrapperdataslidetypecoverpage socialiconssizeextralargesocialiconsstylesolidsqsslidecontainerdataslidetypepopupoverlaynewsletterstyleoutlineresponsivewrappernotstackedlockstyleregulartweethandlesvgsocialbackgroundcolor222sqsslidewrapperdataslidetypecoverpagebordercoloruseiconfill3b5998sqsslidewrapperdataslidetypecoverpageinputtypetextsqsslidewrapperdataslidetypecoverpage sqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinlinesqsslidecontainerdataslidetypepopupoverlaybuttonstyleoutlineli ahoversqsslidewrapperdataslidetypecoverpagedataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizeextrasmallsocialiconsstyleknockoutalignmentright responsivewrapperstackeddataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizeextralargesocialiconsstyleknockoutdataslicetypesocialiconshover dribbblehoversqsslicealbumplaylistplayingeaseintransitionopacityfoursquarehoverfivehundredpixhoverul lieasesqsslidewrapperdataslidetypecoverpageuseiconfill55aceesqsslidewrapperdataslidetypecoverpagecodepenhover170ms easeinoutotransitionbackgroundcolor 170msdataslicetypesocialicons googleplaytracksocialiconssizelargesocialiconsstyleregulargalleryvideobackgroundiconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizeextralargesocialiconsstyleknockoutimportantsqsslidewrapperdataslidetypecoverpage sqsslidecontainernotautoimagebackgroundcolor2s easeinmoztransitionopacitybuttonsqsslidewrapperdataslidetypecoverpage sqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinlinelockstyleborderdataslicetypesocialiconshover stitcherhoversqsslidecontainerdataslidetypepopupoverlaybuttonlayoutstyleinlineauto dataslicetypebuttonsinputtypesubmitsqsslidewrapperdataslidetypecoverpageaudioplayericonsstylesolid dataslicetypealbumhoverflickrhovervevohoveryoutubehoverformitemsqsslidewrapperdataslidetypecoverpage sqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinlineuseiconfillea4c89sqsslidewrapperdataslidetypecoverpageuseiconfill222sqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover goodreadssqsslidecontainernotautoimagebackgroundcolorspotifyhoverbuttonstyleoutlinedataslicetypebuttons asqsslidewrapperdataslidetypecoverpageformwrapper inputtypesubmitsqsslidewrapperdataslidetypecoverpagesvgsocialbackgroundcolorrgba3434344sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstylesolidresponsivewrapperstacked dataslicetypebuttons ulvinegoogleplayhover170ms easeinoutdataslicetypesocialiconshover vinedataslicetypesocialiconshover vscodataslicetypebuttons ahoversqsslidewrapperdataslidetypecoverpagesqsslicealbumplaylist tracks track100mspasswordstylerectangle dataslicetypepasswordeaseinotransitionopacity 2s2sdataslicetypebodyimportantsqsslidewrapperdataslidetypecoverpageresponsivewrapperstacked sqsslicecustomformmediumhoverdataslicetypesocialiconshover tumblrhoversocialiconssizesmallsocialiconsstylesolidmaxwidth600pxsqsslidewrapperdataslidetypecoverpagegithubsocialiconssizemediumsocialiconsstyleborder1situnesdataslicetypelockiconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizemediumsocialiconsstylesoliduldataslicetypepassword inputtypepasswordsqsslidewrapperdataslidetypecoverpagerdiodataslicetypesocialiconshover vimeohoverlightboxcontent formwrappergooglebandsintownhoversocialiconssizeextralargesocialiconsstylesolid170ms easeoutopacity 170msdataslicetypebuttons li0msdataslicetypetwitter tweetavatardataslicetypesocialicons squarespaceiconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizelargesocialiconsstyleknockoutsqssliceplaybuttoniconwrappersqsslidewrapperdataslidetypecoverpagesocialiconsstylesolid dataslicetypesocialiconsaudioplayericonsstyleborderusemaskfillrgba3434344sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleknockoutdataslicetypebuttons ulshowtracktitledataslicetypealbum tracktitleuseiconfillfffsqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstylesolidiconwrapperwidth36pxheight36pxmargin0buttonsqsslidewrapperdataslidetypecoverpage sqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinline actionsstackedarrowicontwitchuseiconfill00b4b3sqsslidewrapperdataslidetypecoverpageusemaskfillrgba3434344sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleknockout dataslicetypesocialiconshoverdataslicetypesocialicons rdiodataslicetypebuttons ul lidataslicetypesocialicons foursquaredataslicetypesocialiconshover iconwrapperpasswordstyleunderlined dataslicetypepassworddataslicetypesocialiconshover instagramhoverbuttonplaypauseiconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizesmallsocialiconsstyleknockoutdataslicetypelock usebackgroundfilltransparentsqsslidewrapperdataslidetypecoverpageuseiconfill000sqsslidewrapperdataslidetypecoverpagedatacompoundtypepopupoverlayactionsqsslidecontainerdataslidetypepopupoverlaybuttonlayoutstyleinlinesocialstacked dataslicetypesocialiconsuseiconfillae995asqsslidewrapperdataslidetypecoverpageeaseinoutmstransitionbackgroundcolor 170msflickrdataslicetypesocialiconshover spotifyhoverdataslicetypesocialiconshover behancehoversocialiconssizeextrasmallsocialiconsstyleknockoutdataslicetypesocialicons vscouseiconfille6b91esqsslidewrapperdataslidetypecoverpageerrormessagesqsslidewrapperdataslidetypecoverpagedataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizelargesocialiconsstylesoliddataslicetypesocialicons thedotsinputtypesubmitsqsslidewrapperdataslidetypecoverpage buttonstyleoutline datacompoundtypepopupoverlayactionsqsalbumminimal dataslicetypealbum sqsslicealbumplayliststackeddataslicetypesocialiconshover spotifyusemaskfill222sqsslidewrapperdataslidetypecoverpagedataslicetypesocialicons mediumuseiconfill0063dcsqsslidewrapperdataslidetypecoverpage0px 0pxlinkedinhoverdataslicetypesocialiconshover itunesdatacompoundtypepopupoverlayaction inputtypetextsqsslidewrapperdataslidetypecoverpageaudioplayericonsstyleknockoutdataslicetypesocialicons goodreadsdataslicetypesocialiconshover dropboxhovertrackssocialiconssizemediumsocialiconsstylesoliddataslicetypesocialiconshover fivehundredpixhoversoundcloudsocialiconssizesmallsocialiconsstyleknockoutdataslicetypebuttons ulstackedsocialiconsstyleknockoutdataslicetypesocialiconshover redditdataslicetypealbum iconwrapperlockstylesolid dataslicetypelocksqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabledrsshoversqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinline actionsnotstackeddataslicetypealbum trackprogressbar170ms easeinoutotransitionbackgroundcoloraudioplayericonsstylesolidsqsalbumminimal dataslicetypealbum sqsslicealbumplaylistdataslicetypesocialiconshover flickrhoversquarespacehoveractionsstacked inputwrappericonwrapperlastchildmarginright0sqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover yelplightboxinner lightboxcontenttidaldataslicetypesocialicons redditformwrapper pbuttonsqsslidewrapperdataslidetypecoverpagep ahoversqsslidewrapperdataslidetypecoverpagesvgsocialwebkittransitionbackgroundcolordataslicetypebuttonssocialiconssizemediumsocialiconsstyleknockoutdataslicetypesocialiconshover behancebordercolor 170msvideoiconstyleborderapplepodcasthoversqsslidewrapperdataslidetypecoverpage dataslicetypebuttonsdataslicetypesocialicons itunessocialstackedtextalignleft dataslicetypesocialiconsdataslicetypesocialicons applepodcastfoursquarestackeddataslicetypesocialiconslayerfrontgoodreadshovertidalhovereaseinout0 0sqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover vevohovereaseinotransitionopacityeaseinouttransitionbackgroundcolordataslicetypesocialiconshover applepodcastsocialiconsstyleregularresponsivewrapperstackedtextaligncenterdribbblestitchereaseoutopacity 170msdataslicetypesocialicons snapchat2s easeinmstransitionopacity 2suseiconfill84bd00sqsslidewrapperdataslidetypecoverpageasqsslidewrapperdataslidetypecoverpage dataslicetypetwitterdataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizemediumsocialiconsstyleknockout170ms easeinout bordercoloruseiconfill00b488sqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover facebookhovergalleryvideobackgroundmobilesocialiconscolorstandardsocialiconsstylesoliddataslicetypesocialiconshover foursquarespansqsslidewrapperdataslidetypecoverpagedataslicetypesocialicons fivehundredpixeaseinoutmstransitioncolordataslicetypesocialiconshover houzzsqsslidecontainerdataslidetypepopupoverlaybuttonlayoutstyleinline dataslicetypebuttonssvgsocialbackgroundcolorrgba3434344sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconshovericonwrapperborder2pxbuttontypesubmitsqsslidewrapperdataslidetypecoverpagesocialiconsstyleborder2s easeinotransitionopacity 2sgmnoprintdataslicetypesocialicons svgsocialbackgroundcolortransparentsqsslidewrapperdataslidetypecoverpagedataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizelargesocialiconsstyleknockoutdataslicetypesocialiconshover ituneshoversvgsocialbackgroundcolorrgba3434344sqsslidewrapperdataslidetypecoverpagesocialiconscolorstandardsocialiconsstyleregularvideoiconstyleknockouticonwrapperdataslicetypesocialicons pinterestdataslicetypesocialiconshover6px2s easeinotransitionopacity

Longtail Keyword Density for M-e-m.jp

KeywordsOccurences
use-iconfillrgba2552552554sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-iconshover44
use-iconfillfffsqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-iconshover44
use-iconfillfffsqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-icons44
use-iconfillfffsqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-knockout data-slice-typesocial-icons44
sqs-modal-lightbox-content lightbox-inner lightbox-content19
170ms ease-in-out border-color15
ease-in-out border-color 170ms15
sqs-album-minimal data-slice-typealbum sqs-slice-album-playlist14
lightbox-inner lightbox-content form-wrapper14
use-iconfill222sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-border data-slice-typesocial-icons12
data-slice-typealbum sqs-slice-album-playlist tracks11
socialstackedtext-align-left data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page10
socialstacked data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page10
170ms ease-in-outtransitionbackground-color 170ms8
170ms ease-in-out-moz-transitionbackground-color 170ms8
170ms ease-in-out-o-transitionbackground-color 170ms8
170ms ease-in-out-ms-transitionbackground-color 170ms8
sqs-slice-album-playlist tracks track7
svgsocialbackground-colorrgba3434344sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-iconshover6
svgsocialbackground-color222sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-regular data-slice-typesocial-icons6
use-maskfillrgba3434344sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-knockout data-slice-typesocial-iconshover6
svgsocialbackground-color222sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-iconshover6
use-maskfill222sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-icons6
show-track-title sqs-album-minimal data-slice-typealbum6
use-iconfill222sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-regular data-slice-typesocial-iconshover6
use-iconfillrgba3434344sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-regular data-slice-typesocial-iconshover6
2em 0px 0px6
use-maskfill222sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-knockout data-slice-typesocial-iconshover6
ease-in-outtransitionbackground-color 170ms ease-in-outsqs-slide-wrapperdata-slide-typecover-page6
data-slice-typebuttons ul lisqs-slide-wrapperdata-slide-typecover-page6
ease-in-out-o-transitionbackground-color 170ms ease-in-outtransitionbackground-color6
ease-in-out-ms-transitionbackground-color 170ms ease-in-out-o-transitionbackground-color6
responsive-wrapperstacked data-slice-typenavigation ul6
ease-in-out-moz-transitionbackground-color 170ms ease-in-out-ms-transitionbackground-color6
data-slice-typebuttons li asqs-slide-wrapperdata-slide-typecover-page5
170ms ease-outopacity 170ms5
responsive-wrapperstacked data-slice-typebuttons ul5
data-slice-typenavigation ul li5
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline actionsnotstacked input-wrappernothidden4
data-slice-typebuttons ul li4
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabledbutton-style-outline data-slice-typebuttons li4
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabled data-slice-typebody p4
lightbox-content form-wrapper p4
svgsocial-webkit-transitionbackground-color 170ms ease-in-out-moz-transitionbackground-color4
social-icons-style-solid data-slice-typesocial-iconshover icon-wrapperhover4
all and max-width600pxsqs-slide-wrapperdata-slide-typecover-page4
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline actionsstacked input-wrapper3
buttonsqs-slide-wrapperdata-slide-typecover-page sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline actionsstacked3
inputtypesubmitsqs-slide-wrapperdata-slide-typecover-page button-style-outline data-compound-typepopup-overlay-action3
sqs-slide-wrapperdata-slide-typecover-page data-slice-typecountdown countdown-contentdata-formatnumeric3
data-slice-typecountdown countdown-contentdata-formattextual countdown-unit3
data-slice-typebuttons li ahoversqs-slide-wrapperdata-slide-typecover-page3
button-style-outlinesqs-modal-lightbox form-wrapper inputtypesubmitsqs-slide-wrapperdata-slide-typecover-page3
form-wrapper inputtypesubmitsqs-slide-wrapperdata-slide-typecover-page button-style-outline3
social-icons-style-solid data-slice-typesocial-iconshover icon-wrapper3
responsive-wrapperstacked data-slice-typebuttons ulsqs-slide-wrapperdata-slide-typecover-page3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-extra-largesocial-icons-style-solid3
screen and max-width600pxsqs-slide-wrapperdata-slide-typecover-page3
ul li asqs-slide-wrapperdata-slide-typecover-page3
2s ease-in-moz-transitionopacity 2s3
2s ease-in-ms-transitionopacity 2s3
2s ease-in-o-transitionopacity 2s3
2s ease-intransitionopacity 2s3
border-color 170ms ease-in-outsqs-slide-wrapperdata-slide-typecover-page3
sqs-album-minimal data-slice-typealbum sqs-slice-album-playlistdemo-album3
sqs-album-minimal data-slice-typealbum sqs-slice-album-playliststacked3
asqs-slide-wrapperdata-slide-typecover-page button-style-outline sqs-slice-custom-form3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-extra-largesocial-icons-style-knockout3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-extra-smallsocial-icons-style-knockout3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-extra-smallsocial-icons-style-solid3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-smallsocial-icons-style-knockout3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-smallsocial-icons-style-solid3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-mediumsocial-icons-style-knockout3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-mediumsocial-icons-style-solid3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-largesocial-icons-style-knockout3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-largesocial-icons-style-solid3
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline actionsstacked input-wrappernothidden3
social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-iconshover176
social-icons-color-standardsocial-icons-style-border data-slice-typesocial-icons176
social-icons-color-standardsocial-icons-style-regular data-slice-typesocial-iconshover88
social-icons-color-standardsocial-icons-style-knockout data-slice-typesocial-iconshover88
social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-icons88
use-iconfillfffsqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-solid88
use-iconfillfffsqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-knockout44
social-icons-color-standardsocial-icons-style-regular data-slice-typesocial-icons44
social-icons-color-standardsocial-icons-style-knockout data-slice-typesocial-icons44
use-iconfillrgba2552552554sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-solid44
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page34
sqs-album-minimal data-slice-typealbum25
sqs-modal-lightbox-content lightbox-inner21
socialstackedtext-align-left data-slice-typesocial-icons20
socialstacked data-slice-typesocial-icons20
lightbox-inner lightbox-content19
data-slice-typecountdown countdown-contentdata-formatnumeric18
border-color 170ms15
data-slice-typealbum sqs-slice-album-playlist15
170ms ease-in-out15
ease-in-out border-color15
lightbox-content form-wrapper14
data-slice-typegallery gallery-video-background14
data-slice-typebuttons ul14
170ms ease-in-outsqs-slide-wrapperdata-slide-typecover-page13
data-slice-typenavigation ul12
use-iconfill222sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-border12
sqs-slide-containerdata-slide-typepopup-overlay data-compound-typepopup-overlay-action12
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline actionsnotstacked12
sqs-slice-album-playlist tracks11
data-slice-typecountdown countdown-contentdata-formattextual11
0 0sqs-slide-wrapperdata-slide-typecover-page11
data-slice-typealbum icon-wrapper11
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline actionsstacked11
data-slice-typebuttons li10
data-slice-typealbum icon-wrapperlast-childmargin-right0sqs-slide-wrapperdata-slide-typecover-page10
data-slice-typealbum icon-wrappersqs-slide-wrapperdata-slide-typecover-page10
data-slice-typealbum icon-wrapperlast-childsqs-slide-wrapperdata-slide-typecover-page10
password-style-underlined data-slice-typepassword10
responsive-wrapperstacked data-slice-typebuttons9
ul li9
li asqs-slide-wrapperdata-slide-typecover-page9
responsive-wrapperstacked data-slice-typenavigation9
password-style-rectangle data-slice-typepassword9
170ms ease-in-outtransitionbackground-color8
data-slice-typebody p8
data-slice-typebuttons ulsqs-slide-wrapperdata-slide-typecover-page8
170ms ease-in-out-moz-transitionbackground-color8
ease-in-outtransitionbackground-color 170ms8
ease-in-out-moz-transitionbackground-color 170ms8
170ms ease-in-out-ms-transitionbackground-color8
data-slice-typebuttons asqs-slide-wrapperdata-slide-typecover-page8
ease-in-out-ms-transitionbackground-color 170ms8
170ms ease-in-out-o-transitionbackground-color8
ease-in-out-o-transitionbackground-color 170ms8
social-icons-style-solid data-slice-typesocial-iconshover8
ul lisqs-slide-wrapperdata-slide-typecover-page7
social-icons-style-border data-slice-typesocial-icons7
button-style-outlinesqs-modal-lightbox form-wrapper7
button-style-outline data-compound-typepopup-overlay-action7
show-track-title sqs-album-minimal7
sqs-slice-custom-form asqs-slide-wrapperdata-slide-typecover-page7
tracks track7
use-maskfillrgba3434344sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-knockout6
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabled data-compound-typepopup-overlay-action6
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-style-outline data-compound-typepopup-overlay-action6
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-style-rectangle data-compound-typepopup-overlay-action6
svgsocialbackground-color222sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-regular6
0px 0px6
audio-player-icons-style-border data-slice-typealbum6
data-slice-typealbum track-progress-bar6
use-maskfill222sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-knockout6
form-wrapper inputtypesubmitsqs-slide-wrapperdata-slide-typecover-page6
2em 0px6
use-iconfill222sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-regular6
svgsocialbackground-color222sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-solid6
button-style-outline sqs-slice-custom-form6
use-maskfill222sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-solid6
data-slice-typesocial-iconshover icon-wrapperhover6
button-style-outline data-slice-typebuttons6
svgsocialbackground-colorrgba3434344sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-solid6
use-iconfillrgba3434344sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-regular6
data-slice-typesocial-icons itunes5
data-slice-typesocial-icons linkedin5
data-slice-typesocial-icons medium5
data-slice-typesocial-icons meetup5
data-slice-typesocial-icons imdb5
data-slice-typesocial-icons instagram5
data-slice-typesocial-icons goodreads5
data-slice-typesocial-icons google5
data-slice-typesocial-icons googleplay5
data-slice-typesocial-icons github5
data-slice-typesocial-icons foursquare5
data-slice-typesocial-icons flickr5
alignment-right responsive-wrapperstacked5
data-slice-typesocial-icons pinterest5
data-slice-typesocial-icons vimeo5
alignment-center responsive-wrapperstacked5
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabled data-slice-typebody5
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-style-underlined data-compound-typepopup-overlay-action5
lock-style-regular data-slice-typelock5
data-slice-typesocial-iconshover icon-wrapper5
ease-outopacity 170ms5
170ms ease-outopacity5
0ms 0ms5
data-slice-typesocial-icons youtube5
data-slice-typesocial-icons yelp5
data-slice-typesocial-icons facebook5
data-slice-typesocial-icons vsco5
data-slice-typesocial-icons vine5
data-slice-typesocial-icons vevo5
data-slice-typesocial-icons rdio5
data-slice-typesocial-icons twitter5
data-slice-typesocial-icons twitch5
data-slice-typesocial-icons tumblr5
data-slice-typesocial-icons tidal5
data-slice-typesocial-icons thedots5
data-slice-typesocial-icons stumbleupon5
data-slice-typesocial-icons stitcher5
data-slice-typesocial-icons squarespace5
data-slice-typesocial-icons spotify5
data-slice-typesocial-icons soundcloud5
data-slice-typesocial-icons snapchat5
data-slice-typesocial-icons smugmug5
data-slice-typesocial-icons rss5
data-slice-typesocial-icons reddit5
data-slice-typesocial-icons fivehundredpix5
data-slice-typesocial-icons houzz5
data-slice-typesocial-icons email5
2s 2s5
data-slice-typesocial-icons applepodcast5
data-slice-typesocial-icons bandsintown5
data-slice-typesocial-icons behance5
data-slice-typesocial-icons codepen5
sqs-slide-wrapperdata-slide-typecover-page data-slice-typebuttons5
data-slice-typealbum sqs-slice-album-playlistplaying5
data-slice-typesocial-icons dribbble5
asqs-slide-wrapperdata-slide-typecover-page button-style-outline5
data-slice-typesocial-icons dropbox5
data-slice-typepassword inputtypepassword-moz-placeholdercolorfffsqs-slide-wrapperdata-slide-typecover-page4
data-slice-typesocial-iconshover twitterhover4
data-slice-typesocial-iconshover twitter4
data-slice-typesocial-iconshover twitchhover4
data-slice-typesocial-iconshover email4
data-slice-typesocial-iconshover tumblrhover4
data-slice-typesocial-iconshover tumblr4
data-slice-typesocial-iconshover tidalhover4
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabledbutton-style-outline data-compound-typepopup-overlay-action4
data-slice-typesocial-iconshover tidal4
data-slice-typesocial-iconshover thedotshover4
data-slice-typesocial-iconshover stumbleuponhover4
data-slice-typesocial-iconshover thedots4
data-slice-typesocial-iconshover stumbleupon4
data-slice-typesocial-iconshover stitcherhover4
data-slice-typesocial-iconshover stitcher4
data-slice-typesocial-iconshover squarespacehover4
responsive-wrapperstacked sqs-slice-custom-form4
data-slice-typesocial-iconshover squarespace4
data-slice-typesocial-iconshover spotifyhover4
data-slice-typesocial-iconshover spotify4
data-slice-typesocial-iconshover soundcloudhover4
data-slice-typesocial-iconshover soundcloud4
data-slice-typesocial-iconshover vevo4
data-slice-typesocial-iconshover vevohover4
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabledbutton-style-outline data-slice-typebuttons4
data-compound-typepopup-overlay-action inputtypetextsqs-slide-wrapperdata-slide-typecover-page4
lock-style-border data-slice-typelock4
data-slice-typetwitternotdata-compound-type tweet-body4
data-slice-typealbumhover icon-wrapperhover4
data-slice-typealbumhover icon-wrapper4
audio-player-icons-style-solid data-slice-typealbumhover4
svgsocial-webkit-transitionbackground-color 170ms4
actionsnotstacked input-wrappernothidden4
buttonsqs-slide-wrapperdata-slide-typecover-page sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline4
form-wrapper p4
data-slice-typebuttons lisqs-slide-wrapperdata-slide-typecover-page4
data-slice-typesocial-iconshover youtubehover4
data-slice-typesocial-iconshover vimeo4
data-slice-typesocial-iconshover youtube4
data-slice-typesocial-iconshover yelphover4
data-slice-typesocial-iconshover yelp4
data-compound-typepopup-overlay-action inputtypetext-moz-placeholdercolorrgba1631631635sqs-slide-wrapperdata-slide-typecover-page4
data-slice-typesocial-iconshover vscohover4
data-slice-typesocial-iconshover vsco4
data-slice-typesocial-iconshover snapchat4
data-slice-typesocial-iconshover vinehover4
data-slice-typesocial-iconshover vine4
data-slice-typesocial-iconshover vimeohover4
data-slice-typesocial-iconshover snapchathover4
data-slice-typesocial-iconshover twitch4
data-slice-typesocial-iconshover smugmughover4
data-slice-typesocial-iconshover codepen4
data-slice-typesocial-iconshover dropbox4
data-slice-typesocial-iconshover itunes4
data-slice-typesocial-iconshover instagramhover4
data-slice-typesocial-iconshover instagram4
data-slice-typesocial-iconshover githubhover4
data-slice-typesocial-iconshover imdbhover4
data-slice-typesocial-iconshover imdb4
data-slice-typesocial-iconshover behancehover4
data-slice-typesocial-iconshover houzzhover4
data-slice-typesocial-iconshover houzz4
data-slice-typesocial-iconshover googlehover4
data-slice-typesocial-iconshover google4
data-slice-typesocial-iconshover googleplayhover4
data-slice-typesocial-iconshover bandsintownhover4
data-slice-typesocial-iconshover fivehundredpix4
data-slice-typesocial-iconshover googleplay4
data-slice-typesocial-iconshover codepenhover4
data-slice-typesocial-iconshover goodreadshover4
data-slice-typesocial-iconshover fivehundredpixhover4
data-slice-typesocial-iconshover flickr4
data-slice-typesocial-iconshover flickrhover4
data-slice-typesocial-iconshover goodreads4
data-slice-typesocial-iconshover dribbblehover4
data-slice-typesocial-iconshover foursquare4
data-slice-typesocial-iconshover foursquarehover4
data-slice-typesocial-iconshover dribbble4
data-slice-typesocial-iconshover ituneshover4
data-slice-typesocial-iconshover behance4
data-slice-typesocial-iconshover linkedin4
data-slice-typesocial-iconshover pinteresthover4
data-slice-typesocial-iconshover smugmug4
data-slice-typesocial-iconshover emailhover4
data-slice-typesocial-iconshover rsshover4
data-slice-typesocial-iconshover rss4
social-icons-style-regular data-slice-typesocial-icons4
data-slice-typesocial-iconshover reddithover4
data-slice-typesocial-iconshover reddit4
data-slice-typesocial-iconshover rdiohover4
data-slice-typesocial-iconshover dropboxhover4
data-slice-typesocial-iconshover rdio4
data-slice-typesocial-iconshover applepodcast4
data-slice-typesocial-iconshover facebook4
data-slice-typesocial-iconshover github4
data-slice-typesocial-iconshover pinterest4
data-slice-typesocial-iconshover bandsintown4
data-slice-typesocial-iconshover linkedinhover4
data-slice-typesocial-iconshover applepodcasthover4
data-slice-typesocial-iconshover facebookhover4
data-slice-typesocial-iconshover meetuphover4
data-slice-typesocial-iconshover meetup4
data-slice-typesocial-iconshover medium4
data-slice-typesocial-iconshover mediumhover4
actionsstacked input-wrappernothidden3
lock-style-solid data-slice-typelock3
data-slice-typegallery gallery-video-backgroundmobile3
lock-style-knockout data-slice-typelock3
data-slice-typelock use-backgroundfilltransparentsqs-slide-wrapperdata-slide-typecover-page3
ease-intransitionopacity 2s3
layer-front sqs-slide-layer-content3
data-slice-typetwitternotdata-compound-type tweet-timestamp3
ease-in-moz-transitionopacity 2s3
ease-in-ms-transitionopacity 2s3
sqs-slide-containerdata-slide-typepopup-overlay captcha-container-wrapper3
2s ease-intransitionopacity3
2s ease-in-o-transitionopacity3
field-errordisplayblockpositionabsolutebox-sizingborder-boxpadding25em 5emfont14px3
importantsqs-slide-wrapperdata-slide-typecover-page sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline3
ease-in-o-transitionopacity 2s3
li ahoversqs-slide-wrapperdata-slide-typecover-page3
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-stacked input-wrapper3
form-itemsqs-slide-wrapperdata-slide-typecover-page sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline3
2s ease-in-ms-transitionopacity3
data-compound-typepopup-overlay-action error-messagesqs-slide-wrapperdata-slide-typecover-page3
2s ease-in-moz-transitionopacity3
inputtypetextsqs-slide-wrapperdata-slide-typecover-page sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline3
importantsqs-slide-wrapperdata-slide-typecover-page sqs-slide-containernotauto-image-background-color3
actionsstacked input-wrapper3
data-slice-typemap gm-style-cc3
social-icons-style-solid data-slice-typesocial-icons3
data-slice-typepassword arrow-icon3
ease-in-outsqs-slide-wrapperdata-slide-typecover-page social-icons-style-solid3
sqs-slice-custom-form spansqs-slide-wrapperdata-slide-typecover-page3
data-compound-typepopup-overlay-action buttontypesubmitsqs-slide-wrapperdata-slide-typecover-page3
data-slice-typetwitter tweet-avatar3
asqs-slide-wrapperdata-slide-typecover-page data-slice-typetwitter3
data-slice-typepassword inputtypepasswordsqs-slide-wrapperdata-slide-typecover-page3
2s easesqs-slide-wrapperdata-slide-typecover-page3
icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-extra-smallsocial-icons-style-knockout3
data-slice-typemap gmnoprint3
icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-extra-smallsocial-icons-style-solid3
icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-smallsocial-icons-style-knockout3
icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-smallsocial-icons-style-solid3
icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-mediumsocial-icons-style-knockout3
icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-mediumsocial-icons-style-solid3
icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-largesocial-icons-style-knockout3
icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-largesocial-icons-style-solid3
icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-extra-largesocial-icons-style-solid3
data-slice-typebuttons ulstacked3
p asqs-slide-wrapperdata-slide-typecover-page3
social-icons-style-knockout data-slice-typesocial-icons3
inputtypesubmitsqs-slide-wrapperdata-slide-typecover-page button-style-outline3
data-slice-typesocial-icons use-maskfilltransparentsqs-slide-wrapperdata-slide-typecover-page3
data-slice-typesocial-icons svgsocialbackground-colortransparentsqs-slide-wrapperdata-slide-typecover-page3
audio-player-icons-style-regular data-slice-typealbum3
data-slice-typealbum track-title3
form-wrapper inputtypesubmithoversqs-slide-wrapperdata-slide-typecover-page3
sqs-slice-custom-form ahoversqs-slide-wrapperdata-slide-typecover-page3
data-slice-typebuttons ahoversqs-slide-wrapperdata-slide-typecover-page3
sqs-slide-containerdata-slide-typepopup-overlaybutton-layout-style-inline-auto data-slice-typebuttons3
p ahoversqs-slide-wrapperdata-slide-typecover-page3
sqs-slide-containerdata-slide-typepopup-overlaybutton-layout-style-auto data-slice-typebuttons3
sqs-slide-containerdata-slide-typepopup-overlaybutton-layout-style-inline data-slice-typebuttons3
data-slice-typealbum sqs-slice-album-playlistdemo-album3
data-slice-typealbum sqs-slice-album-playliststacked3
countdown-contentdata-formattextual countdown-unit3
only screen3
sqs-slide-wrapperdata-slide-typecover-page data-slice-typecountdown3
icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-extra-largesocial-icons-style-knockout3
sqs-slide-wrapperdata-slide-typecover-page responsive-wrappernotstacked3
data-slice-typesocial-icons440
data-slice-typesocial-iconshover364
social-icons-color-standardsocial-icons-style-solid264
social-icons-color-standardsocial-icons-style-border176
use-iconfillfffsqs-slide-wrapperdata-slide-typecover-page140
social-icons-color-standardsocial-icons-style-regular132
social-icons-color-standardsocial-icons-style-knockout132
data-slice-typealbum109
170ms90
data-slice-typebuttons63
data-compound-typepopup-overlay-action60
sqs-slide-containerdata-slide-typepopup-overlay54
icon-wrappersqs-slide-wrapperdata-slide-typecover-page46
use-iconfillrgba2552552554sqs-slide-wrapperdata-slide-typecover-page44
2s41
asqs-slide-wrapperdata-slide-typecover-page39
data-slice-typecountdown35
importantsqs-slide-wrapperdata-slide-typecover-page34
data-slice-typegallery33
responsive-wrapperstacked31
data-slice-typelock30
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline29
data-slice-typepassword29
form-wrapper28
sqs-album-minimal27
ul26
1s25
0sqs-slide-wrapperdata-slide-typecover-page25
sqs-modal-lightbox-content24
use-iconfill222sqs-slide-wrapperdata-slide-typecover-page24
sqs-slice-custom-form24
icon-wrapper23
lightbox-inner22
data-slice-typenavigation21
li21
socialstackedtext-align-left20
sqs-slide-wrapperdata-slide-typecover-page20
socialstacked20
020
button-style-outline19
lightbox-content19
countdown-contentdata-formatnumeric18
ease-in-outsqs-slide-wrapperdata-slide-typecover-page17
sqs-slice-album-playlist17
tracks16
border-color15
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabled15
ease-in-out15
data-slice-typebody15
gallery-video-background14
p13
sqs-modal-lightbox-open13
ahoversqs-slide-wrapperdata-slide-typecover-page13
lisqs-slide-wrapperdata-slide-typecover-page12
actionsnotstacked12
social-icons-style-solid12
icon-wrapperhover12
svgsocialbackground-color222sqs-slide-wrapperdata-slide-typecover-page12
0px12
use-maskfill222sqs-slide-wrapperdata-slide-typecover-page12
countdown-contentdata-formattextual11
password-style-underlined11
actionsstacked11
password-style-rectangle11
data-slice-typetwitter11
sqs-slice-play-buttonicon-wrappersqs-slide-wrapperdata-slide-typecover-page10
all10
squarespace10
110
0ms10
icon-wrapperlast-childmargin-right0sqs-slide-wrapperdata-slide-typecover-page10
solid10
data-slice-typetwitternotdata-compound-type10
icon-wrapperlast-childsqs-slide-wrapperdata-slide-typecover-page10
foursquare9
itunes9
bandsintown9
behance9
linkedin9
codepen9
dribbble9
dropbox9
email9
instagram9
imdb9
houzz9
google9
fivehundredpix9
googleplay9
goodreads9
github9
flickr9
facebook9
vimeo9
medium9
tumblr9
layer-front9
ease-in-out-moz-transitionbackground-color9
ease-in-out-ms-transitionbackground-color9
ease-in-out-o-transitionbackground-color9
ease-in-outtransitionbackground-color9
youtube9
meetup9
vsco9
vine9
vevo9
twitter9
twitch9
yelp9
tidal9
smugmug9
pinterest9
max-width600pxsqs-slide-wrapperdata-slide-typecover-page9
rdio9
reddit9
rss9
applepodcast9
thedots9
snapchat9
soundcloud9
spotify9
stitcher9
stumbleupon9
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabledbutton-style-outline8
ulsqs-slide-wrapperdata-slide-typecover-page8
sqs-slide-containerdata-slide-typepopup-overlayoverlay-alignment-center8
data-slice-typealbumhover8
sqs-slide-layer-content8
sqs-slice-play-buttonicon-wrapper8
input-wrappernothidden7
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-stacked7
inputtypetextsqs-slide-wrapperdata-slide-typecover-page7
use-iconfillrgba3434344sqs-slide-wrapperdata-slide-typecover-page7
use-backgroundfilltransparentsqs-slide-wrapperdata-slide-typecover-page7
alignment-center7
use-backgroundfillfffsqs-slide-wrapperdata-slide-typecover-page7
alignment-right7
button-style-outlinesqs-modal-lightbox7
track7
spansqs-slide-wrapperdata-slide-typecover-page7
video-icon-style-border7
show-track-title7
data-slice-typemap7
social-icons-style-border7
inputtypesubmitsqs-slide-wrapperdata-slide-typecover-page6
10px6
2em6
sqs-slice-play-buttonicon-wrapperhover6
input-wrapper6
button-style-raised6
svgsocialbackground-colorrgba3434344sqs-slide-wrapperdata-slide-typecover-page6
social-icons-style-regular6
use-maskfillrgba3434344sqs-slide-wrapperdata-slide-typecover-page6
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-style-outline6
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-style-rectangle6
ulstacked6
audio-player-icons-style-border6
track-progress-bar6
audio-player-icons-style-solid6
sqs-slide-containerdata-slide-typepopup-overlayoverlay-alignment-left6
rdiohover5
button-shape-rounded-corners5
meetuphover5
rsshover5
gmnoprint5
gm-style-cc5
linkedinhover5
pinteresthover5
reddithover5
svgsocial-webkit-transitionbackground-color5
social-icons-style-knockout5
smugmughover5
ituneshover5
mediumhover5
snapchathover5
button-shape-pill5
stumbleuponhover5
use-maskfilltransparentsqs-slide-wrapperdata-slide-typecover-page5
sqs-slice-album-playlistplaying5
ease-outopacity5
6px5
youtubehover5
100ms5
yelphover5
vscohover5
vinehover5
vimeohover5
vevohover5
soundcloudhover5
twitterhover5
twitchhover5
tumblrhover5
tidalhover5
thedotshover5
stitcherhover5
audio-player-icons-style-regular5
squarespacehover5
spotifyhover5
instagramhover5
foursquarehover5
imdbhover5
01s5
facebookhover5
emailhover5
dropboxhover5
githubhover5
dribbblehover5
goodreadshover5
buttonsqs-slide-wrapperdata-slide-typecover-page5
codepenhover5
googleplayhover5
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-style-underlined5
flickrhover5
behancehover5
googlehover5
tweet-timestamp5
bandsintownhover5
lock-style-regular5
applepodcasthover5
houzzhover5
stackeddata-slice-typesocial-icons5
fivehundredpixhover5
track-title4
inputtypetext-moz-placeholdercolorrgba1631631635sqs-slide-wrapperdata-slide-typecover-page4
neuearialsans-seriffont-weight700font-stylenormalfont-size16pxtext-transformnoneletter-spacing01emsqs-slide-wrapperdata-slide-typecover-page4
form-itemsqs-slide-wrapperdata-slide-typecover-page4
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabledbutton-style-raised4
5px4
icon-wrapperwidth24pxheight24pxmargin04
displaytablesqs-slide-wrapperdata-slide-typecover-page4
video-icon-style-regular4
4px4
video-icon-style-solid4
lock-style-border4
inputtypepassword-moz-placeholdercolorfffsqs-slide-wrapperdata-slide-typecover-page4
map-style-minimal-dark4
neuearialsans-seriffont-weight400font-stylenormalletter-spacing6pxsqs-slide-wrapperdata-slide-typecover-page4
audio-player-icons-style-knockout4
use-iconfilltransparentsqs-slide-wrapperdata-slide-typecover-page4
tweet-body4
ease-in-o-transitionopacity3
ease-in-out-ms-transitioncolor3
sqs-slide-containerdata-slide-typepopup-overlayoverlay-load-animation-slide-in3
adisplayblocksqs-slide-wrapperdata-slide-typecover-page3
3px3
ease-in-outtransitioncolor3
ease-in-out-o-transitioncolor3
actionssqs-slide-wrapperdata-slide-typecover-page3
icon-wrapperwidth28pxheight28pxmargin03
sqs-slide-containerdata-slide-typepopup-overlayenable-overlay-content-border3
responsive-wrapper3
responsive-wrappernotstacked3
ease-in-out-moz-transitioncolor3
ease-in-ms-transitionopacity3
sqs-slidesqs-slide-animation-ready3
countdown-unit3
sqs-slicedata-content-emptytruedisplaynonesqs-slide-wrapperdata-slide-typecover-page3
ease-intransitionopacity3
fffsqs-slide-wrapperdata-slide-typecover-page3
captcha-container-wrapper3
sqs-slide-containerdata-slide-typepopup-overlaybutton-layout-style-inline3
autoflex13
data-slice-typebuttonssqs-slide-wrapperdata-slide-typecover-page3
sqs-slide-containerdata-slide-typepopup-overlaybutton-style-outline3
data-slice-typegallerysqs-gallery-grid3
svgsocialbackground-colortransparentsqs-slide-wrapperdata-slide-typecover-page3
field-errordisplayblockpositionabsolutebox-sizingborder-boxpadding25em3
sqs-slide-containernotauto-image-background-color3
5emfont14px3
autosqs-slide-wrapperdata-slide-typecover-page3
video-icon-style-knockout3
use-iconfill222background-color222sqs-slide-wrapperdata-slide-typecover-page3
gallery-video-backgroundmobile3
inputtypesubmithoversqs-slide-wrapperdata-slide-typecover-page3
responsive-wrapperstackedtext-align-center3
icon-wrapperdiv-webkit-transformscale2-moz-transformscale2-ms-transformscale2transformscale2sqs-slide-wrapperdata-slide-typecover-page3
error-messagesqs-slide-wrapperdata-slide-typecover-page3
ease-in-moz-transitionopacity3
button-style-solid3
lock-style-solid3
sqs-slide-containerdata-slide-typepopup-overlaybutton-layout-style-inline-auto3
sqs-slice-custom-formsqs-slide-wrapperdata-slide-typecover-page3
lock-style-knockout3
sqs-slide-containerdata-slide-typepopup-overlaybutton-layout-style-auto3
icon-wrapperborder2px3
disclaimer-containersqs-slide-wrapperdata-slide-typecover-page3
use-iconfill0063dcsqs-slide-wrapperdata-slide-typecover-page3
use-iconfill007ee5sqs-slide-wrapperdata-slide-typecover-page3
8px3
social-icons-size-largesocial-icons-style-regular3
use-iconfill3b5998sqs-slide-wrapperdata-slide-typecover-page3
social-icons-size-mediumsocial-icons-style-regular3
use-iconfill0099e5sqs-slide-wrapperdata-slide-typecover-page3
social-icons-size-smallsocial-icons-style-regular3
social-icons-size-extra-smallsocial-icons-style-regular3
use-iconfillea4c89sqs-slide-wrapperdata-slide-typecover-page3
use-iconfillf94877sqs-slide-wrapperdata-slide-typecover-page3
14px3
arrow-icon3
use-iconfill4183c4sqs-slide-wrapperdata-slide-typecover-page3
easesqs-slide-wrapperdata-slide-typecover-page3
use-iconfill382110sqs-slide-wrapperdata-slide-typecover-page3
inputtypepasswordsqs-slide-wrapperdata-slide-typecover-page3
social-icons-size-extra-largesocial-icons-style-regular3
social-icons-size-extra-smallsocial-icons-style-border3
avisitedsqs-slide-wrapperdata-slide-typecover-page3
social-icons-size-mediumsocial-icons-style-solid3
social-icons-size-extra-largesocial-icons-style-solid3
use-iconfill000sqs-slide-wrapperdata-slide-typecover-page3
social-icons-size-extra-largesocial-icons-style-knockout3
social-icons-size-extra-largesocial-icons-style-border3
social-icons-size-largesocial-icons-style-solid3
social-icons-size-largesocial-icons-style-knockout3
social-icons-size-largesocial-icons-style-border3
social-icons-size-mediumsocial-icons-style-knockout3
social-icons-size-extra-smallsocial-icons-style-knockout3
use-iconfill00b4b3sqs-slide-wrapperdata-slide-typecover-page3
social-icons-size-mediumsocial-icons-style-border3
use-iconfill1769ffsqs-slide-wrapperdata-slide-typecover-page3
social-icons-size-smallsocial-icons-style-solid3
social-icons-size-smallsocial-icons-style-knockout3
social-icons-size-smallsocial-icons-style-border3
social-icons-size-extra-smallsocial-icons-style-solid3
use-iconfill5adfcbsqs-slide-wrapperdata-slide-typecover-page3
use-iconfilldc4e41sqs-slide-wrapperdata-slide-typecover-page3
1px3
button-play-pause3
only3
sqs-slice-album-playliststacked3
use-iconfill6441a5sqs-slide-wrapperdata-slide-typecover-page3
sqs-slice-album-playlistdemo-album3
use-iconfill55aceesqs-slide-wrapperdata-slide-typecover-page3
use-iconfillff0031sqs-slide-wrapperdata-slide-typecover-page3
use-iconfill1ab7easqs-slide-wrapperdata-slide-typecover-page3
use-iconfill00b488sqs-slide-wrapperdata-slide-typecover-page3
use-iconfill8c8070sqs-slide-wrapperdata-slide-typecover-page3
use-iconfillae995asqs-slide-wrapperdata-slide-typecover-page3
use-iconfillc41200sqs-slide-wrapperdata-slide-typecover-page3
7px3
use-iconfille52d27sqs-slide-wrapperdata-slide-typecover-page3
icon-wrapperwidth36pxheight36pxmargin03
data-slice-typeheadingnotdata-compound-type3
icon-wrapperwidth32pxheight32pxmargin03
screen3
use-iconfilleb4924sqs-slide-wrapperdata-slide-typecover-page3
use-iconfill7ac143sqs-slide-wrapperdata-slide-typecover-page3
use-iconfill0976b4sqs-slide-wrapperdata-slide-typecover-page3
tweet-handle3
use-iconfille6b91esqs-slide-wrapperdata-slide-typecover-page3
tweet-display-name3
use-iconfille4405fsqs-slide-wrapperdata-slide-typecover-page3
tweet-avatar3
use-iconfillec4652sqs-slide-wrapperdata-slide-typecover-page3
sqs-modal-lightbox3
use-iconfill00ab6csqs-slide-wrapperdata-slide-typecover-page3
use-iconfill1ea9e1sqs-slide-wrapperdata-slide-typecover-page3
use-iconfille0393esqs-slide-wrapperdata-slide-typecover-page3
buttontypesubmitsqs-slide-wrapperdata-slide-typecover-page3
use-iconfillcc2127sqs-slide-wrapperdata-slide-typecover-page3
use-iconfill006ed2sqs-slide-wrapperdata-slide-typecover-page3
use-iconfillff4500sqs-slide-wrapperdata-slide-typecover-page3
use-iconfill7dbb00sqs-slide-wrapperdata-slide-typecover-page3
use-iconfillf60sqs-slide-wrapperdata-slide-typecover-page3
use-iconfill84bd00sqs-slide-wrapperdata-slide-typecover-page3
use-iconfill35465dsqs-slide-wrapperdata-slide-typecover-page3

Who hosts M-e-m.jp?

M-e-m.jp Hosting Provider Information

Hosted IP Address:198.185.159.135
Hosted Hostname:198.185.159.135
Service Provider:Squarespace, Inc.
Hosted Country:United StatesUS
Location Latitude:40.7157
Location Longitude:-74
Webserver Software:Squarespace

Is "Squarespace, Inc." in the Top 10 Hosting Companies?

Name
Percentage
GoDaddy.com, LLC
9.5100%
DoD Network Information Center
8.4509%
Google Inc.
2.8338%
Confluence Networks Inc
2.6217%
Amazon.com, Inc.
2.1737%
Namecheap, Inc.
2.1384%
TOT Public Company Limited
1.5665%
1&1 Internet AG
1.5512%
Merit Network Inc.
1.3856%
Unified Layer
1.3043%
Squarespace, Inc.
1.2345%

HTTP Header Analysis for M-e-m.jp

Http-Version: 1.1
Status-Code: 301
Status: 301 Moved Permanently
date: Fri, 16 Oct 2020 08:43:25 GMT
location: https://www.m-e-m.jp/
Age: 59401
Content-Length: 0
x-contextid: O152vy2S/KzOB161O
server: Squarespace

M-e-m.jp Domain Nameserver Information

HostIP AddressCountry
ns1.xserver.jp 219.94.200.246
ns2.xserver.jp 157.112.182.225
ns3.xserver.jp 219.94.200.247
ns4.xserver.jp 219.94.203.247
ns5.xserver.jp 157.112.182.218


Need to find out who hosts M-e-m.jp?


Domain Registration (WhoIs) information for M-e-m.jp

 [ JPRS database provides information on network administration. Its use is ]
[ restricted to network administration purposes. For further information, ]
[ use 'whois -h whois.jprs.jp help'. To suppress Japanese output, add'/e' ]
[ at the end of command, e.g. 'whois -h whois.jprs.jp xxx/e'. ]

Domain Information:
[Domain Name] M-E-M.JP

[Registrant] BET Inc.

[Name Server] ns1.xserver.jp
[Name Server] ns2.xserver.jp
[Name Server] ns3.xserver.jp
[Name Server] ns4.xserver.jp
[Name Server] ns5.xserver.jp
[Signing Key]

[Created on] 2012/04/29
[Expires on] 2018/04/30
[Status] Active
[Last Updated] 2017/05/01 01:05:10 (JST)

Contact Information:
[Name] XSERVER Inc.
[Email] Login to show email
Page] http://www.xserver.co.jp
[Postal code] 530-0011
[Postal Address] GRAND FRONT OSAKA TOWER A 13F,
4-20, Ofukacho,
Kita-ku, Osaka-City, Osaka
[Phone] 06-6292-8811
[Fax] 06-6292-8812

Websites with Similar Names

M-e-m-o-r-i-a.page
Memoria 記憶時尚 - 服飾店

Recently Updated Websites

Florinalungu.com (1 second ago.)Freewashwednesday.com (2 seconds ago.)Findingyourrealadventure.com (2 seconds ago.)Fosterhercrown.com (2 seconds ago.)Faraprotection.com (3 seconds ago.)Freedomsantizer.com (3 seconds ago.)Fullstoryfilmsllc.com (3 seconds ago.)Friscosbeer.com (3 seconds ago.)Frasesdecarinho.com (4 seconds ago.)Digitalbackflowgauge.com (4 seconds ago.)Flythrume.com (5 seconds ago.)Gdbigbang.com (6 seconds ago.)Floridastemcelltreatmentforhair.com (6 seconds ago.)Ecom4exit.com (6 seconds ago.)Drivethucomedy.com (6 seconds ago.)Ecs-chemicals.com (7 seconds ago.)Getbatchnbake.com (7 seconds ago.)Fukkenclothing.com (7 seconds ago.)Fortsimpleoutpost.com (7 seconds ago.)Covidretrofit.com (8 seconds ago.)Fitgesundattraktiv.com (8 seconds ago.)Fsr-gmac.com (8 seconds ago.)Ftryjiaobeijiu.com (9 seconds ago.)Fundiodyssey.com (9 seconds ago.)Gigopt.com (9 seconds ago.)Stretchednotbroken.com (9 seconds ago.)Fuhqpaeme.com (11 seconds ago.)Gatewayppg.com (11 seconds ago.)G3rodamientos.com (11 seconds ago.)Foreverj4u.com (12 seconds ago.)

Recently Searched Keywords

dohányzóasztal (1 second ago.)путин согласился продать беларуси месторождение нефти (2 seconds ago.)north mississippi (2 seconds ago.)unfiltered (2 seconds ago.)bitsonline (4 seconds ago.)[트위치] [철웅맨][워해머토탈워] 크록가르는 강하..나 (5 seconds ago.)windowbindresize (6 seconds ago.)прогноз курса белорусского рубля: укрепление к доллару и евро может продолжиться (6 seconds ago.)the 2000s (6 seconds ago.)perak (7 seconds ago.)финансы белорусской промышленности вошли в пике (7 seconds ago.)mehr sport (8 seconds ago.)aging care advocates (8 seconds ago.)заражение (9 seconds ago.)235px 05 (9 seconds ago.)var imagewidth (10 seconds ago.)my coupon (10 seconds ago.)sản phẩm chất lượng cao nhất dựa trên quy trình thống nhất, nghiêm ngặt của dasavina (11 seconds ago.)победа джо байдена может привести к обвалу курса доллара на московской бирже (11 seconds ago.)140 139 (11 seconds ago.)言情 (12 seconds ago.)rwby wiki (12 seconds ago.)basket add-product-popupremoveclasssmall (13 seconds ago.)000 40 (13 seconds ago.)кредиты на автомобиль (15 seconds ago.)july 2014 hindu calendar (18 seconds ago.)project 2 (19 seconds ago.)gesichtspflege (20 seconds ago.)0 rgba0001 (20 seconds ago.)vista rápida (23 seconds ago.)