|  MA-Shops - 500.000 Muenzen Altdeutschland bis Euromünzen - Antike, Zubehör Gold Vatikan
Low trust score  | 
MA-Shops Münzen 500.000 Muenzen von Antike bis Euro. Einmaliges Angebot von vielen Fachhändlern, Altdeutschland, Medaillen und Antike Münzen - Euro Monaco Vatikan Marino Taler Kaiserreich Weimar bis Euro und Zubehör - Auch Muenzen deutschland und Gold Silbermünzen Mark und KMS Website Information

Website Ranks & Scores for

Statvoo Rank Statvoo Rank:G
Alexa Rank Alexa Rank:134,357
Majestic Rank Majestic Rank:549,967
Domain Authority Domain Authority:44%
DMOZ DMOZ Listing:No

Whois information for

Full Whois Lookup for Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

% Copyright (c) 2010 by DENIC
% Version: 2.0
% Restricted rights.
% Terms and Conditions of Use
% The data in this record is provided by DENIC for informational purposes only.
% DENIC does not guarantee its accuracy and cannot, under any circumstances,
% be held liable in case the stored information would prove to be wrong,
% incomplete or not accurate in any sense.
% All the domain data that is visible in the whois service is protected by law.
% It is not permitted to use it for any purpose other than technical or
% administrative requirements associated with the operation of the Internet.
% It is explicitly forbidden to extract, copy and/or use or re-utilise in any
% form and by any means (electronically or not) the whole or a quantitatively
% or qualitatively substantial part of the contents of the whois database
% without prior and explicit written permission by DENIC.
% It is prohibited, in particular, to use it for transmission of unsolicited
% and/or commercial and/or advertising by phone, fax, e-mail or for any similar
% purposes.
% By maintaining the connection you assure that you have a legitimate interest
% in the data and that you will only use it for the stated purposes. You are
% aware that DENIC maintains the right to initiate legal proceedings against
% you in the event of any breach of this assurance and to bar you from using
% its whois service.
% The DENIC whois service on port 43 never discloses any information concerning
% the domain holder/administrative contact. Information concerning the domain
% holder/administrative contact can be obtained through use of our web-based
% whois service available at the DENIC website:

Status: connect
Changed: 2014-04-11T09:39:17+02:00

Name: Joachim Schwiening
Address: Lankerner Str. 42
PostalCode: 46395
City: Bocholt
CountryCode: DE
Phone: +49.28712393415
Fax: +49.28712393414
Email: Login to show email

Name: Joachim Schwiening
Address: Lankerner Str. 42
PostalCode: 46395
City: Bocholt
CountryCode: DE
Phone: +49.28712393415
Fax: +49.28712393414
Email: Login to show email

Who hosts is hosted by Level 3 Communications, Inc. in Nordrhein-westfalen, Koeln, Germany, 51149. has an IP Address of and a hostname of Web Server Information

Hosted IP Address:
Service Provider:Level 3 Communications, Inc.
Hosted Country:GermanyDE
Location Latitude:50.9333
Location Longitude:6.95
Webserver Software:Not Applicable
Google Map of 50,12

HTTP Header Analysis for

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Mon, 27 Jul 2015 07:13:18 GMT
Server: Apache/2.2.22 (Ubuntu)
X-Powered-By: PHP/5.3.10-1ubuntu3.19
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-cache, must-revalidate
Pragma: no-cache
Vary: Accept-Encoding,User-Agent
Content-Encoding: gzip
Content-Length: 37925
Content-Type: text/html

Need to find out who hosts Free SEO Report

Website Inpage Analysis for

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for

hansensedehanseatenscaley11mnzenkuperskyanacsseit 7 tagenmashop rittig3625000 eur7pxhoehnsvcollectoralle artikel neu50 pfg3012500 eur15artikelstckertkaribik sdamerikapcgsvacante ecu au3832500 eur mashopul shopmenulidocumentreadyfunction settimeout functiondrsilber platin14dr stadleraudes39 50coinpalmyraheritagecoin wienau stlambert 1792langcurrmenu ul lipoinsignon frplatinmashop stcker2255000 eur mashopbriefemashop pollandthoverbowenstadtccccccul langmenuullicurrmenueur mashop klner100000 eur mashop37nluiautocompleteeur mashop stckerptnumismatosliege sede vacanteeur mashop oldingantikewertpapiereul shopmenuli ul7 tagenreturnnbesbisfrankreichpaddingkleyer25000 eur mashoplangmenu ulkocieur mashop fenzl2mai briefmarkenliloginmenuli liabsilbernonehildmashop klnerpeus318000 eurfischer3320settimeout function setintervalvacantepaterlots sammlungen ngc8ul ulngc pcgsliege sedetetradrachmli visitedgold silberantike objektesieem oostbrabant nleurmmagora nl1centerbraunschweigul limashop henzenmartikel neuvarsolid ccccccbremenlangcurrmenu ulauftirolpfg kleinerhamiltonrepublikmashop palmyraheritageliegeahoverillishopmenulieur mashop palmyraheritagelangcurrmenuklnerstlambert 1792ngcsnnmiteur mashop rittigtopitemsmainpagegalleryeur mashopsetintervalfenzl6lotsmaieur mashop hamiltonaltdeutschland16weltfraustralien und ozeanienroose nlmagallerylastvisiteddocumentreadyfunctionknker10wittebackgroundcolorartikel neu seitzubehrgoudbeek nlnumisbriefe28eur mashop henzenfunctioneventfalsemedaillensvcollector grbackgroundcolorffffffdanzig minr25vor13banknotenliloginmenulirooseiideutschesfaecusmashop ars coinpfgnswleipzig drpoplnder ortemashop laurens schulmaneurangebot vonoostbrabantmittelalterstlambertnumismatikdeutsches reichlishopmenuli likornblumarsliteraturnumismatos ptboersema nl26sonstigelangcurrmenu ul ulfranquinetboddears coinstadlerkleinerli a langcurrmenuscreencookieplfunction setinterval functionseleucid31planetsettimeoutdeutschland abgerhard7busso peus9henzen nlm oostbrabant27mashop wittefbdescriptiontschopppcgs anacs sonstigepcgs anacsboersemabussoanacs sonstige18russlanditalien4oostbrabant nlgodutosede vacanteneusede vacante ecufbpost fbdescriptionsaiveeur mashop pollandtkoci czliohne11spaniengoduto nlsectorbuttonclickcountercgb frdylla gerhardmadessdamerika32500 eurplanet numismaticsgtnordamerika mittelamerikasetinterval functionfbpostmarginafrika asien australiengold silber platinoldingeurangeboteur mashop oberndsammlungen ngc pcgsartikel gtsterreichstaateneuromnzenvon12bcklner mnzkabinett5searchtextinputvaluiitemlabeltextlilangmenuwiensettimeout functionifhankepoinsignonagoraelse35schulman nlnswleipzigmashop rittermashopsmashop henzen nllinnartzneu seitmittelamerikachhenzenfunctionfunction setintervallilangmenu liavisitedlots sammlungentriggerlndermashop arsdeutschlandloebberssolidmashop pladeckjsneuzugngeortehistorische29statedeutschland ab 1871visitednswleipzig dr hansennotmnzen19dr kaczynskiul langmenu ulmashop obernd5pxlangcurrmenu limashop laurensecu aupladeckminr 39palmyraheritage usa100000 eurkohlrossars coin wienpollandtobjekteafrikasammlungenseitmashop klner mnzkabinettlaurens schulmanmashop fenzlclickkunstngc pcgs anacsdeutschemashop oldingthemeneur mashop wittewein24niederlandezengiden23mnzkabinetttschopp chmilitariamashop hamilton bowenminr 39 50nordamerika12500 eur mashopidclick 15000au stlambertdr bussonebengebietemedaillen lnderkaczynski21shopmenuliliimprintmenu liamerikausaliimprintmenuasien australien17walschlangmenunumismaticskaribikli lifischer ekbriefmarkensekapaanverticalalignmiddledr busso peuseur mashop ritterritterasientextdecorationnoneeur mashop arsallewidth100px32minrdocumentreadyfunction settimeoutvacante ecudkdyllaul li ulneuzugnge gteuromashoplaurensozeanienhardeltab 1871tagenknopekrmischemashop hamiltontrigger clickdr hildschulmanalle artikelshopmenuli ulecu au stlambert50 pfg kleinercgbaustralienleftczbrdzengiden vondanzighanseaten bremeneur mashop pladeckseit 7newbackgroundpositionli ulmashop dr bussoobernd55000 eurdisplayinlineblocksaive frampgaeblerul ul lirittighossfeldafrika asien39 50 pfgekeur mashop drukmashop palmyraheritage usareturn falsemashop drtrigger click 15000shopneu seit 7kingdomeur mashop laurensmashop dr kaczynskiseleucid kingdom18000 eur mashopfjseuropadanzig minr 39dr hansenhamilton bowenmedaillen lnder orte5px 5pxgrfontweightboldmotivmnzen34sammlungen ngcreichmnzhgoldlaurens schulman nlgmargin 0goudbeekaltdeutschland deutschland0

Longtail Keyword Density for

documentreadyfunction settimeout function13
function setinterval function13
settimeout function setinterval13
trigger click 1500013
langcurrmenu ul ul12
eur ma-shop dr11
medaillen lnder orte11
ngc pcgs anacs10
langcurrmenu ul li8
eur ma-shop stcker7
eur ma-shop pollandt6
ma-shop hamilton bowen6
eur ma-shop hamilton6
dr busso peus6
ul ul li6
laurens schulman nl5
pcgs anacs sonstige5
ars coin wien5
eur ma-shop fenzl4
ma-shop dr kaczynski4
eur ma-shop klner4
artikel neu seit4
ul li ul4
ma-shop dr busso4
ma-shop henzen nl4
seit 7 tagen4
eur ma-shop henzen4
m oost-brabant nl4
neu seit 74
ma-shop klner mnzkabinett4
alle artikel neu4
afrika asien australien4
au stlambert 17923
ecu au stlambert3
danzig minr 393
minr 39 503
39 50 pfg3
ma-shop palmyraheritage usa3
ul langmenu ul3
ul shopmenuli ul3
li a langcurrmenu3
100000 eur ma-shop3
eur ma-shop obernd3
eur ma-shop palmyraheritage3
vacante ecu au3
32500 eur ma-shop3
50 pfg kleiner3
eur ma-shop rittig3
eur ma-shop laurens3
ma-shop laurens schulman3
25000 eur ma-shop3
18000 eur ma-shop3
nsw-leipzig dr hansen3
australien und ozeanien3
deutschland ab 18713
lots sammlungen ngc3
sammlungen ngc pcgs3
eur ma-shop pladeck3
gold silber platin3
eur ma-shop olding3
12500 eur ma-shop3
liege sede vacante3
eur ma-shop witte3
ma-shop ars coin3
55000 eur ma-shop3
eur ma-shop ritter3
eur ma-shop ars3
sede vacante ecu3
eur ma-shop120
langcurrmenu ul27
ul li21
ul ul16
setinterval function13
settimeout function13
documentreadyfunction settimeout13
function setinterval13
click 1500013
trigger click13
neuzugnge gt12
artikel gt12
lnder orte11
ma-shop dr11
medaillen lnder11
ngc pcgs10
pcgs anacs10
li visited10
hamilton bowen8
alle artikel7
return false7
ma-shop stcker7
schulman nl7
ma-shop pollandt6
lots sammlungen6
klner mnzkabinett6
dr kaczynski6
henzen nl6
dr busso6
ma-shop hamilton6
busso peus6
eurangebot von5
neu seit5
anacs sonstige5
palmyraheritage usa5
asien australien5
li ul5
laurens schulman5
coin wien5
solid cccccc5
7 tagen5
ars coin5
seit 74
artikel neu4
fbpost fbdescription4
lishopmenuli li4
liimprintmenu li4
langcurrmenu li4
ma-shop henzen4
lilangmenu li4
liloginmenuli li4
afrika asien4
saive fr4
goudbeek nl4
m oost-brabant4
ma-shop fenzl4
cgb fr4
ma-shop klner4
oost-brabant nl4
mai briefmarken4
ma-shop obernd3
ma-shop palmyraheritage3
ma-shop ars3
au stlambert3
32500 eur3
ecu au3
55000 eur3
sede vacante3
ma-shop ritter3
100000 eur3
pfg kleiner3
50 pfg3
minr 393
ma-shop olding3
12500 eur3
danzig minr3
39 503
ma-shop rittig3
ma-shop witte3
liege sede3
seleucid kingdom3
vacante ecu3
stlambert 17923
silber platin3
fischer ek3
dylla gerhard3
dr stadler3
goduto nl3
hanseaten bremen3
dr hansen3
nsw-leipzig dr3
koci cz3
dr hild3
boersema nl3
ul shopmenuli3
li li3
margin 03
shopmenuli ul3
ul langmenu3
agora nl3
5px 5px3
langmenu ul3
numismatos pt3
planet numismatics3
sammlungen ngc3
zengiden von3
antike objekte3
nordamerika mittelamerika3
karibik sdamerika3
18000 eur3
25000 eur3
ma-shop laurens3
ab 18713
deutschland ab3
svcollector gr3
roose nl3
poinsignon fr3
tschopp ch3
deutsches reich3
altdeutschland deutschland3
gold silber3
ma-shop pladeck3

What are the nameservers for Domain Nameserver Information

HostIP AddressCountry Germany Germany DNS Record Analysis DNS Lookup

Serial: 2014112611
Refresh: 16384
Retry: 2048
Expire: 1048576
ma-shops.deMX86400Priority: 50
ma-shops.deTXT86400TXT: v=spf1 a mx ip4:

Alexa Traffic Rank for

Alexa Search Engine Traffic for