Ma-shops.de  |  MA-Shops - 500.000 Muenzen Altdeutschland bis Euromünzen - Antike, Zubehör Gold Vatikan
Low trust score  | 
MA-Shops Münzen 500.000 Muenzen von Antike bis Euro. Einmaliges Angebot von vielen Fachhändlern, Altdeutschland, Medaillen und Antike Münzen - Euro Monaco Vatikan Marino Taler Kaiserreich Weimar bis Euro und Zubehör - Auch Muenzen deutschland und Gold Silbermünzen Mark und KMS




Ma-shops.de Website Information

Website Ranks & Scores for Ma-shops.de

Statvoo Rank Statvoo Rank:G
Alexa Rank Alexa Rank:134,357
Majestic Rank Majestic Rank:549,967
Domain Authority Domain Authority:44%
DMOZ DMOZ Listing:No

Whois information for ma-shops.de

Full Whois Lookup for Ma-shops.de Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Ma-shops.de. Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

% Copyright (c) 2010 by DENIC
% Version: 2.0
%
% Restricted rights.
%
% Terms and Conditions of Use
%
% The data in this record is provided by DENIC for informational purposes only.
% DENIC does not guarantee its accuracy and cannot, under any circumstances,
% be held liable in case the stored information would prove to be wrong,
% incomplete or not accurate in any sense.
%
% All the domain data that is visible in the whois service is protected by law.
% It is not permitted to use it for any purpose other than technical or
% administrative requirements associated with the operation of the Internet.
% It is explicitly forbidden to extract, copy and/or use or re-utilise in any
% form and by any means (electronically or not) the whole or a quantitatively
% or qualitatively substantial part of the contents of the whois database
% without prior and explicit written permission by DENIC.
% It is prohibited, in particular, to use it for transmission of unsolicited
% and/or commercial and/or advertising by phone, fax, e-mail or for any similar
% purposes.
%
% By maintaining the connection you assure that you have a legitimate interest
% in the data and that you will only use it for the stated purposes. You are
% aware that DENIC maintains the right to initiate legal proceedings against
% you in the event of any breach of this assurance and to bar you from using
% its whois service.
%
% The DENIC whois service on port 43 never discloses any information concerning
% the domain holder/administrative contact. Information concerning the domain
% holder/administrative contact can be obtained through use of our web-based
% whois service available at the DENIC website:
% http://www.denic.de/en/domains/whois-service/web-whois.html
%

Domain: ma-shops.de
Nserver: ns1.hans.hosteurope.de
Nserver: ns2.hans.hosteurope.de
Status: connect
Changed: 2014-04-11T09:39:17+02:00

[Tech-C]
Type: PERSON
Name: Joachim Schwiening
Address: Lankerner Str. 42
PostalCode: 46395
City: Bocholt
CountryCode: DE
Phone: +49.28712393415
Fax: +49.28712393414
Email: Login to show email
2014-04-11T09:05:19+02:00

[Zone-C]
Type: PERSON
Name: Joachim Schwiening
Address: Lankerner Str. 42
PostalCode: 46395
City: Bocholt
CountryCode: DE
Phone: +49.28712393415
Fax: +49.28712393414
Email: Login to show email
2014-04-11T09:05:19+02:00

Who hosts Ma-shops.de?

Ma-shops.de is hosted by Level 3 Communications, Inc. in Nordrhein-westfalen, Koeln, Germany, 51149.
Ma-shops.de has an IP Address of 80.237.191.172 and a hostname of ma-shops.de.



Ma-shops.de Web Server Information

Hosted IP Address:80.237.191.172
Hosted Hostname:ma-shops.de
Service Provider:Level 3 Communications, Inc.
Hosted Country:GermanyDE
Location Latitude:50.9333
Location Longitude:6.95
Webserver Software:Not Applicable

HTTP Header Analysis for Ma-shops.de

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Mon, 27 Jul 2015 07:13:18 GMT
Server: Apache/2.2.22 (Ubuntu)
X-Powered-By: PHP/5.3.10-1ubuntu3.19
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-cache, must-revalidate
Pragma: no-cache
Vary: Accept-Encoding,User-Agent
Content-Encoding: gzip
Content-Length: 37925
Content-Type: text/html


Need to find out who hosts Ma-shops.de?

Ma-shops.de Free SEO Report

Website Inpage Analysis for Ma-shops.de

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Ma-shops.de

nswleipzig droostbrabantul shopmenuliarsminr 39 50ul langmenu ulagora nlplanet numismatics5px 5pxul li426seitsetinterval functionhenzen nlaustralien5falselilangmenugoduto nlid18pcgs anacskaribikeur mashop pladeckcoinmnzkabinettpcgs anacs sonstigerittigli ultschopp chli libackgroundcolorffffff12500 eurstatemashop hamiltonneuzugngehanseaten bremenkuperskyroose nlvonwittestaatentrigger clickeur mashop fenzlnewlots sammlungen ngclangcurrmenu ul lifunctioneventpoinsignonminr 3916stadlerhovervarfbdescriptionmashop rittigkoci czeur mashopbackgroundpositionoberndars coin wien32500 eurklnerul ul licznumismatos ptgrweltshop37eurangebot vonseit 7 tagenmashop laurensgold silbergt33ukpoinsignon frdr stadlermashop arsdeutschland ab 1871altdeutschland deutschlandreichtriggerknopek38wertpapiereeur mashop hamiltonmashop ritter30sedeul shopmenuli ulwidth100pxreturnneu seit 7laurens schulman nlcgb frmashop klneranacs sonstigehistorischefabussohamilton bowenmargin 0lisede vacante27ohnelangcurrmenuozeanienpteur mashop palmyraheritageklner mnzkabinettpfgplatinbowenliloginmenuli lisonstigelilangmenu lilaurens schulmandocumentreadyfunctionlots sammlungenfr7 tagennumismatik5pxschulman nldr hansenpfg kleinereurangebotsearchtextinputvaluiitemlabeltexteuro32500 eur mashopcoin wieneur mashop pollandttextdecorationnoneantike objektem oostbrabantneuzugnge gtpaddingtagenars coinnotmnzen24jsabeur mashop arsbriefmarken8ampkleineraltdeutschlanddanzig minr 39iivor18000 eurngc pcgs anacsau stlambertdessectorbuttonclickcounterkociahoverasien australienecueur mashop oberndlotsdeutschland abhildnonemashop palmyraheritage usapalmyraheritage50 pfgsaive frpalmyraheritage usaafrika asien australienminrnebengebietegsemashopsmashopilmittelalter12500 eur mashopsaive25000 eur14fischereur mashop drdkbusso peus22settimeout function setintervalzengidenesclick 15000shopmenulipopnbmashop oberndhamiltonfunction setintervaloostbrabant nlrusslandhoehnsmashop wittemashop hamilton bowenmashop dr busso9eur mashop witte31fenzldocumentreadyfunction settimeoutecu au11uiautocompleteulboersemaul langmenumashop drbrdartikel neu seitliege sedesetinterval39 50mashop fenzl20296functiondr hildzengiden vonlicurrmenualle artikel neu100000 eurpladeckfjsbanknotenvacante ecuhankemagallerylastvisitedifmashop dr kaczynski39 50 pfgliimprintmenu liab 1871medaillen lnder ortevisitedkingdomau stlambert 1792ritterhanseatenmai35ul li ulkaczynskiscaley11langcurrmenu lilangmenu ultopitemsmainpagegalleryanacshossfeldhenzenscreencookieusatetradrachmmmdeutscheliteraturtirol3deutschesclickbisauniederlandelnderliege sede vacantesterreichamerika10ngc15100000 eur mashopavisitedlinnartzpeus12lishopmenuli lisdamerika1karibik sdamerikaspanienneungc pcgsmashop stcker25000 eur mashoppcgsnumisbriefesilber platinliloginmenulilangcurrmenu ulmai briefmarken25fischer ekboersema nlkleyer7pxlaurensgaeblerseleucid kingdomlnder ortesammlungenaufafrikakapaanecu au stlambertthemenchloebberssettimeout functionfbpost fbdescriptiondisplayinlineblockpollandtul ul55000 eurli a langcurrmenuelseeuropaartikelzubehrantikegodutom oostbrabant nl55000 eur mashopfrankreichseit 7motivmnzenweinmitobjektemashop oldingstlambert 1792mashop henzen nlnordamerikaliegeortemeur mashop oldingrmischesilberitaliendrlangcurrmenu ul ulstlambertdylla gerharddr kaczynskibremenrepublikalle artikelsiee34walschkornblumsolid ccccccgerhardgolddeutschlandpatertschopphardelteur mashop stckerdocumentreadyfunction settimeout functionfbpostartikel gthansenfontweightboldmashop ars coin50 pfg kleiner13dyllagold silber platindr busso peusekmashop pollandteur mashop klnereur mashop henzenvacante ecu aunumismaticsbcccccccalleplanetplwiennswleipzig dr hansensede vacante ecu18000 eur mashopmilitaria7mashop henzenneu seitknkerstadtmnzenlangmenudanzig minrroose17mnzhdeutsches reichstckerdanzigsvcollector grschulmanlishopmenuliseleucidsnndr bussotnleuromnzenbackgroundcolormittelamerikasettimeoutkohlrosssammlungen ngc pcgsmedaillentrigger click 15000cgb2sammlungen ngceur mashop rittigafrika asienbraunschweigreturn falseasiennumismatoskunstgoudbeek nlnordamerika mittelamerika23mashop palmyraheritage36mashop klner mnzkabinettmedaillen lnderagoraeur mashop ritterverticalalignmiddle28briefecenter0olding1921leftmashop pladecksolidliimprintmenuvacanteaustralien und ozeanienfranquineteur mashop laurensboddesvcollectormadesli visitedeurmashop laurens schulmanshopmenuli ulnswleipzigartikel neumarginfunction setinterval functiongoudbeek32

Longtail Keyword Density for Ma-shops.de

KeywordsOccurences
documentreadyfunction settimeout function13
function setinterval function13
settimeout function setinterval13
trigger click 1500013
langcurrmenu ul ul12
eur ma-shop dr11
medaillen lnder orte11
ngc pcgs anacs10
langcurrmenu ul li8
eur ma-shop stcker7
eur ma-shop pollandt6
ma-shop hamilton bowen6
eur ma-shop hamilton6
dr busso peus6
ul ul li6
laurens schulman nl5
pcgs anacs sonstige5
ars coin wien5
eur ma-shop fenzl4
ma-shop dr kaczynski4
eur ma-shop klner4
artikel neu seit4
ul li ul4
ma-shop dr busso4
ma-shop henzen nl4
seit 7 tagen4
eur ma-shop henzen4
m oost-brabant nl4
neu seit 74
ma-shop klner mnzkabinett4
alle artikel neu4
afrika asien australien4
au stlambert 17923
ecu au stlambert3
danzig minr 393
minr 39 503
39 50 pfg3
ma-shop palmyraheritage usa3
ul langmenu ul3
ul shopmenuli ul3
li a langcurrmenu3
100000 eur ma-shop3
eur ma-shop obernd3
eur ma-shop palmyraheritage3
vacante ecu au3
32500 eur ma-shop3
50 pfg kleiner3
eur ma-shop rittig3
eur ma-shop laurens3
ma-shop laurens schulman3
25000 eur ma-shop3
18000 eur ma-shop3
nsw-leipzig dr hansen3
australien und ozeanien3
deutschland ab 18713
lots sammlungen ngc3
sammlungen ngc pcgs3
eur ma-shop pladeck3
gold silber platin3
eur ma-shop olding3
12500 eur ma-shop3
liege sede vacante3
eur ma-shop witte3
ma-shop ars coin3
55000 eur ma-shop3
eur ma-shop ritter3
eur ma-shop ars3
sede vacante ecu3
eur ma-shop120
langcurrmenu ul27
ul li21
ul ul16
setinterval function13
settimeout function13
documentreadyfunction settimeout13
function setinterval13
click 1500013
trigger click13
neuzugnge gt12
artikel gt12
lnder orte11
ma-shop dr11
medaillen lnder11
ngc pcgs10
pcgs anacs10
li visited10
hamilton bowen8
alle artikel7
return false7
ma-shop stcker7
schulman nl7
ma-shop pollandt6
lots sammlungen6
klner mnzkabinett6
dr kaczynski6
henzen nl6
dr busso6
ma-shop hamilton6
busso peus6
eurangebot von5
neu seit5
anacs sonstige5
palmyraheritage usa5
asien australien5
li ul5
laurens schulman5
coin wien5
solid cccccc5
7 tagen5
ars coin5
seit 74
artikel neu4
fbpost fbdescription4
lishopmenuli li4
liimprintmenu li4
langcurrmenu li4
ma-shop henzen4
lilangmenu li4
liloginmenuli li4
afrika asien4
saive fr4
goudbeek nl4
m oost-brabant4
ma-shop fenzl4
cgb fr4
ma-shop klner4
oost-brabant nl4
mai briefmarken4
ma-shop obernd3
ma-shop palmyraheritage3
ma-shop ars3
au stlambert3
32500 eur3
ecu au3
55000 eur3
sede vacante3
ma-shop ritter3
100000 eur3
pfg kleiner3
50 pfg3
minr 393
ma-shop olding3
12500 eur3
danzig minr3
39 503
ma-shop rittig3
ma-shop witte3
liege sede3
seleucid kingdom3
vacante ecu3
stlambert 17923
silber platin3
fischer ek3
dylla gerhard3
dr stadler3
goduto nl3
hanseaten bremen3
dr hansen3
nsw-leipzig dr3
koci cz3
dr hild3
boersema nl3
ul shopmenuli3
li li3
margin 03
shopmenuli ul3
ul langmenu3
agora nl3
5px 5px3
langmenu ul3
numismatos pt3
planet numismatics3
sammlungen ngc3
zengiden von3
antike objekte3
nordamerika mittelamerika3
karibik sdamerika3
18000 eur3
25000 eur3
ma-shop laurens3
ab 18713
deutschland ab3
svcollector gr3
roose nl3
poinsignon fr3
tschopp ch3
deutsches reich3
altdeutschland deutschland3
gold silber3
ma-shop pladeck3
eur125
ma-shop121
ul71
li48
nl44
langcurrmenu41
function35
fr34
if31
dr31
altdeutschland30
var25
gt24
artikel19
mnzen19
medaillen16
015
neu15
documentreadyfunction14
von14
return14
click14
usa13
trigger13
settimeout13
sonstige13
neuzugnge13
visited13
setinterval13
deutschland12
orte11
lnder11
110
ngc10
210
anacs10
pcgs10
ch10
310
stcker9
fbpost9
lots9
briefmarken9
amp9
coin9
europa9
sammlungen8
48
bowen8
hamilton8
pollandt8
alle8
solid8
gold8
58
ab8
themen8
banknoten8
zubehr7
gr7
langmenu7
wien7
asien7
literatur7
67
mashops7
77
olding7
stadt7
uk7
antike7
schulman7
false7
tagen7
numismatics6
reich6
fenzl6
afrika6
kaczynski6
peus6
euro6
mittelalter6
klner6
mnzkabinett6
frankreich6
knker6
henzen6
else6
86
busso6
seit6
laurens5
m5
95
cccccc5
es5
welt5
pl5
lilangmenu5
witte5
pladeck5
rittig5
ritter5
palmyraheritage5
obernd5
eurangebot5
australien5
ecu5
105
id5
il5
magallerylastvisited5
deutsche5
ars5
none4
displayinline-block4
font-weightbold4
rmische4
ohne4
114
t4
left4
js4
walsch4
mit4
des4
sterreich4
siee4
fjs4
spanien4
militaria4
saive4
5px4
euromnzen4
fischer4
ozeanien4
124
134
padding4
sdamerika4
nordamerika4
liloginmenuli4
liimprintmenu4
silber4
ahover4
hover4
ui-autocomplete4
objekte4
vertical-alignmiddle4
lishopmenuli4
deutsches4
144
154
wertpapiere4
s4
fbdescription4
164
shop4
bis4
kupersky4
kornblum4
au4
bodde4
bc4
mnzh4
liege4
franquinet4
kingdom4
goudbeek4
cgb4
gaebler4
linnartz4
knopek4
174
184
mai4
loebbers4
oost-brabant4
se4
tetradrachm3
vor3
auf3
stlambert3
kunst3
italien3
brd3
numismatik3
193
203
sede3
vacante3
seleucid3
numisbriefe3
pfg3
state3
nebengebiete3
213
223
233
searchtextinputvaluiitemlabeltext3
kleiner3
243
253
danzig3
karibik3
braunschweig3
263
273
mittelamerika3
283
minr3
topitemsmainpagegallery3
ii3
293
303
functionevent3
niederlande3
pater3
hild3
stadler3
dylla3
boersema3
agora3
313
323
ma-shops3
gerhard3
ek3
hardelt3
hoehn3
hossfeld3
bremen3
hanseaten3
goduto3
hanke3
333
343
7px3
shopmenuli3
licurrmenu3
background-color3
text-decorationnone3
sectorbuttonclickcounter3
margin3
width100px3
background-colorffffff3
353
363
373
scaley1-13
center3
avisited3
background-position3
dk3
kapaan3
notmnzen3
amerika3
staaten3
motivmnzen3
platin3
tschopp3
wein3
briefe3
historische3
russland3
zengiden3
tirol3
republik3
screencookie3
new3
383
snn3
svcollector3
kohlross3
mm3
nb3
cz3
koci3
mades3
kleyer3
nsw-leipzig3
hansen3
poinsignon3
pop3
roose3
planet3
fa3
numismatos3
pt3
g3

What are the nameservers for ma-shops.de?

Ma-shops.de Domain Nameserver Information

HostIP AddressCountry
ns1.hans.hosteurope.de 217.115.143.140Germany Germany
ns2.hans.hosteurope.de 80.237.128.10Germany Germany

Ma-shops.de Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Ma-shops.de is a scam?