Mac-torrent-download.net  |  Mac Torrent Download
High trust score  | 
Mac Applications & Games Torrent. Apple, Adobe, Photography, Graphics & Design, Business, Finance, Social Networking, News, Office, Developer Tools,

Mac-torrent-download.net Website Information

Mac-torrent-download.net has a High trust score, a Statvoo Rank of B, an Alexa Rank of 6,967, a Majestic Rank of 0, a Domain Authority of 0% and is not listed in DMOZ.

Mac-torrent-download.net is hosted by KNET Techonlogy (BeiJing) Co.,Ltd. in Bangladesh.
Mac-torrent-download.net has an IP Address of 103.84.172.11 and a hostname of 103.84.172.11 and runs Apache/2.4.6 web server.

The domain mac-torrent-download.net was registered 4 years 11 months 3 weeks ago by PDR LTD. D/B/A PUBLICDOMAINREGISTRY.COM, it was last modified 2 years 4 months 3 weeks ago and currently is set to expire 11 months 4 weeks 5 hours ago.


Whois information for mac-torrent-download.net

Full Whois Lookup for Mac-torrent-download.net Whois Lookup

Domain Name: MAC-TORRENT-DOWNLOAD.NET
Registry Domain ID: 1881089493_DOMAIN_NET-VRSN
Registrar WHOIS Server: whois.PublicDomainRegistry.com
Registrar URL: http://www.publicdomainregistry.com
Updated Date: 2017-05-25T06:29:42Z
Creation Date: 2014-10-19T07:40:37Z
Registry Expiry Date: 2018-10-19T07:40:37Z
Registrar: PDR Ltd. d/b/a PublicDomainRegistry.com
Registrar IANA ID: 303
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.2013775952
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Name Server: CLAY.NS.CLOUDFLARE.COM
Name Server: RUTH.NS.CLOUDFLARE.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2017-08-16T22:52:30Z

Who hosts Mac-torrent-download.net?

Mac-torrent-download.net Web Server Information

Hosted IP Address:103.84.172.11
Hosted Hostname:103.84.172.11
Service Provider:KNET Techonlogy (BeiJing) Co.,Ltd.
Hosted Country:BangladeshBD
Location Latitude:23.7
Location Longitude:90.375
Webserver Software:Apache/2.4.6

HTTP Header Analysis for Mac-torrent-download.net

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Sat, 13 Jun 2015 21:02:10 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Last-Modified: Sat, 13 Jun 2015 18:00:16 GMT
Vary: Accept-Encoding
Cache-Control: max-age=0, no-cache, no-store, must-revalidate
Pragma: no-cache
Expires: Mon, 29 Oct 1923 20:30:00 GMT
Server: cloudflare-nginx
CF-RAY: 1f60bc24f377139b-LHR
Content-Encoding: gzip


Need to find out who hosts Mac-torrent-download.net?

Mac-torrent-download.net Free SEO Report

Website Inpage Analysis for Mac-torrent-download.net

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Mac-torrent-download.net

photography namemb createdcrealuts vol1video name pixel11 2017m 8230fcpmusiccollectiondesktopbundle133117clonepro 520tovusound edward foleyartsocial networkinghijack 335topaz remask 503topazvol3utilitiestransitionsnametorrent downloadvideo converter13 20178230 red giantfinal cut prodesign assets graphicsvividtntdmgphotoshop cc8211 prowallkontakttitles v2fcpxwedding luts vol1macos sierraaudiopack 8211complete suite 2017utilities video name2017 nbspnbspmasfilm studiospresets nbspstudios 8211final cuteditornew microsoftcreatedistatmb created 8230winmac nbsp august8211 videoremaskcc 2017keddmg size28productivity namegraphics ampx nameadobe photoshopnbspnbsp office productivitysuite 20172design utilitiesaugust 12 2017effectsfcp titles v2nbspnbsp utilities namestudiophotoshop cc 2017assets graphicscomic pack 8211video nameadobewinmacnewamp designred giant complete8top 1008230 redc 8230wondershare videofcpx and maugust 15 2017nbsp august 11developer toolssiz 8230nbspnbsp utilities27c2017 nbspnbsp developernbspnbsp graphics ampnbsp august 1320mblifestylecrelutpixel film12 2017 nbspnbspgiant complete suite118230 microsoftaugust 16 2017frames comic pack15370 nbspwinmac nbspprowall volumeoffice productivitynbspnbsp musicmb cre 8230vol1nbspnbsp designspecial kpostbox 5017s 82308211 prowall 8230presets nbsp august2017nbspnbspnbspnbspgraphics ampaugust 14adobe photoshop ccgiantpronbsp august 12photoshop2016 vlnbspnbsptovusound edwardaugust 11 2017august 1525x nbsp augustx0381postboxremask 503cut8211 prowall volume24tovusound12 2017menus 532prodropgiant completesharkdmg sizev2design video name22nbspnbsp video namepano2vr pro 5202016 vl 153708211 prodropdesigndesignnamename pixel film16gameedwardfreeze framessierravl 15370 name8230 newampmpano2vr provivid promicrosoft officemb cdesign assetsstudiostriumph18nbspnbsp music name2017 nbspnbsp photographymb creapro x 038studios 8211 prodropmb c 82302017 nbspnbsp officemb cr 8230vl 15370frames comicnbspnbsp photographynetworking015370 nameamp design videopro x nameranking14crx 038professionaldeveloper8230 downie8230 wondershareweeklygraphics ampnbspnbsp officedownloadappaugustpro xfantasymacistat menus 532foleyartautodeskdowniecre 8230utilities name7macosmb crea 8230nbsp august 1423kgmac 2016freezethemecreated 82302017 nbspnbsp graphicssndmcompletecomic5nbspnbsp videocctopaz remask2615studios 8211 prowallfcp titlesx name pixelvideo converter ultimatefinalranking topafter effectsapple6august 12educationkreativ wedding luts8230 wondershare videomusic name16 2017photographycomic packaudio hijackmac torrentviews weeklygraphics amp2017 nbspnbsp utilities2017 nbspnbsp musicnbspnbsp productivity15 201792017 nbspnbsp videoname redenvato fcp titlestriumph 2511size 8230pixel film studios315 2017 nbspnbspname red giantnbsp augustamp designnamenew pixel filmnbspnbsp photography nameautodesk vredcut pro xgb16 2017 nbspnbsp48230 new pixeloffice13 2017 nbspnbspiskysoftadware12suiteranking top 100prowalldesign nameassetsx nbspbuildcr 8230sndmg size10envatokreativfilestorrent038 motionmb 8230pro x nbspcut pro292017nbspnbspnbspnbspgraphicsrecoveryextractutilities videoaccess11 2017 nbspnbspmac torrent downloadaudio hijack 335menusspecialnbsp august 16core30titlesweddingsizsocialsndmgenvato fcp03motionnbspnbsp design assetsnbspnbsp graphicsv2 for finalaugust 11office productivity namemb crnbspsndm 8230pixelgraphicswondersharepano2vrnbspnbsp developernbspnbsp productivity name2017 nbspnbsp productivity8230 iskysoftfilm2017 nbspnbsp designweeklygraphics amp designedward foleyart21name pixelvl 15370 nbspcomplete suiteredviewsmicrosofttheme for final2017nbspnbspnbspnbspgraphics amp designnamex 038 motionvlsizedesign videolightproductivityoffice for macaugust 13 2017hijacknbsp august 1519videovredkreativ weddingnbspnbsp developer tools8230 pixel filmafterdownie 299mb creaugust 14 2017film studios 8211lutsred giantprowall 8230gb 8230keddmg size 8230views weeklygraphics14 2017istat menusconverterwondershare video convertertopblack8230 new microsoftassets graphics ampconverter ultimatepack15370 nbsp august8230 pixel14 2017 nbspnbspwedding lutsultimatenew pixelpresetssharkdmgkeddmgweeklygraphicsamp design nametransitions packamp design utilitiesfreeze frames comicaugust 13sgraphics amp designkvolumecrea 8230toolsframesaugust 16

Longtail Keyword Density for Mac-torrent-download.net

KeywordsOccurences
graphics amp design34
nbspnbsp graphics amp27
2017 nbspnbsp graphics27
pixel film studios26
film studios 821124
nbsp august 1524
15 2017 nbspnbsp24
august 15 201724
final cut pro23
14 2017 nbspnbsp21
nbsp august 1321
august 14 201721
nbsp august 1421
august 13 201721
13 2017 nbspnbsp21
cut pro x20
design video name19
amp design video19
12 2017 nbspnbsp17
august 12 201717
2017 nbspnbsp utilities17
nbsp august 1217
nbspnbsp utilities name15
2017 nbspnbsp music13
name pixel film12
nbspnbsp music name12
16 2017 nbspnbsp10
august 16 201710
nbsp august 1610
8230 pixel film9
amp design name9
x nbsp august9
pro x nbsp9
2017 nbspnbsp productivity8
studios 8211 prowall8
nbspnbsp productivity name8
2017 nbspnbsp video7
11 2017 nbspnbsp7
nbsp august 117
nbspnbsp video name7
mb crea 82307
video name pixel7
august 11 20177
2017 nbspnbsp photography6
pro x name6
2016 vl 153706
envato fcp titles6
office productivity name6
2017 nbspnbsp office6
nbspnbsp office productivity6
x name pixel5
8230 red giant5
mb cr 82305
8230 new microsoft5
nbspnbsp photography name5
fcp titles v25
amp design utilities4
istat menus 5324
complete suite 20174
giant complete suite4
red giant complete4
nbspnbsp developer tools4
nbspnbsp design assets4
2017 nbspnbsp developer4
presets nbsp august4
2017 nbspnbsp design4
design assets graphics4
assets graphics amp4
2017nbspnbspnbspnbspgraphics amp designname4
audio hijack 3354
frames comic pack4
studios 8211 prodrop4
freeze frames comic4
utilities video name4
mac torrent download4
ranking top 1004
pano2vr pro 5204
topaz remask 5034
weeklygraphics amp design4
comic pack 82114
views weeklygraphics amp4
wondershare video converter4
8211 prowall volume4
8211 prowall 82304
tovusound edward foleyart4
vl 15370 name3
kreativ wedding luts3
office for mac3
wedding luts vol13
adobe photoshop cc3
photoshop cc 20173
theme for final3
8230 new pixel3
8230 wondershare video3
video converter ultimate3
mb cre 82303
15370 nbsp august3
mb created 82303
vl 15370 nbsp3
mb c 82303
name red giant3
keddmg size 82303
pro x 0383
winmac nbsp august3
x 038 motion3
new pixel film3
fcpx and m3
v2 for final3
2017 nbspnbsp100
nbsp august100
amp design38
graphics amp34
video name31
nbspnbsp graphics27
pixel film26
film studios26
15 201724
studios 821124
august 1524
final cut23
cut pro23
august 1421
13 201721
august 1321
14 201721
pro x20
utilities name19
design video19
8230 new19
august 1217
nbspnbsp utilities17
12 201717
productivity name14
nbspnbsp music13
name pixel12
music name12
16 201710
size 823010
august 1610
8230 pixel9
x nbsp9
design name9
2016 vl8
red giant8
nbspnbsp productivity8
sndmg size8
8211 prowall8
siz 82308
august 117
keddmg size7
photography name7
fcp titles7
crea 82307
mb crea7
11 20177
nbspnbsp video7
office productivity6
design assets6
nbspnbsp photography6
vl 153706
nbspnbsp office6
x name6
8230 microsoft6
envato fcp6
developer tools6
new microsoft5
microsoft office5
mb cr5
ranking top5
mb 82305
8230 red5
titles v25
s 82305
cr 82305
design utilities4
suite 20174
torrent download4
mac torrent4
istat menus4
complete suite4
giant complete4
assets graphics4
nbspnbsp design4
presets nbsp4
8211 video4
menus 5324
postbox 50174
prowall 82304
vivid pro4
audio hijack4
hijack 3354
triumph 25114
social networking4
pano2vr pro4
autodesk vred4
downie 2994
pro 5204
top 1004
video converter4
wondershare video4
frames comic4
freeze frames4
comic pack4
pack 82114
m 82304
adobe photoshop4
remask 5034
created 82304
views weeklygraphics4
weeklygraphics amp4
topaz remask4
8211 prodrop4
prowall volume4
2017nbspnbspnbspnbspgraphics amp4
tovusound edward4
edward foleyart4
8230 wondershare4
sndm 82304
utilities video4
amp designname4
nbspnbsp developer4
special k3
sharkdmg size3
15370 name3
macos sierra3
after effects3
transitions pack3
mb created3
cc 20173
x 0383
038 motion3
new pixel3
photoshop cc3
mac 20163
kreativ wedding3
wedding luts3
luts vol13
15370 nbsp3
gb 82303
name red3
8230 iskysoft3
8230 downie3
c 82303
mb c3
mb cre3
cre 82303
converter ultimate3
winmac nbsp3
0150
name140
1109
nbsp101
august100
nbspnbsp100
size79
design48
248
amp45
video42
pro40
graphics36
mb28
film27
pixel26
studios26
utilities25
324
final23
cut23
422
521
new21
x20
618
music17
productivity16
office15
714
microsoft13
812
mac12
adobe11
pack11
views10
vl10
photography10
910
sndmg9
0389
red8
prowall8
siz8
giant8
108
fcp7
keddmg7
titles7
crea7
studio6
developer6
assets6
tools6
game6
envato6
downie6
photoshop6
suite6
luts6
app6
converter6
audio6
top5
social5
s5
115
kg5
v25
professional5
cr5
ranking5
fcpx5
c5
macos5
wondershare5
foleyart4
istat4
124
complete4
menus4
134
winmac4
autodesk4
vred4
tntdmg4
mas4
sharkdmg4
black4
recovery4
k4
weeklygraphics4
144
presets4
154
triumph4
164
174
sierra4
postbox4
184
vivid4
fantasy4
194
edward4
hijack4
lut4
204
214
created4
gb4
tovusound4
light4
motion4
volume4
prodrop4
m4
cc4
designname4
networking4
lifestyle4
apple4
224
torrent4
2017nbspnbspnbspnbspgraphics4
download4
234
bundle4
remask4
freeze4
topaz4
244
sndm4
pano2vr4
comic4
frames4
after3
253
access3
cre3
transitions3
263
kontakt3
extract3
files3
editor3
special3
ultimate3
education3
core3
effects3
kreativ3
273
iskysoft3
283
theme3
293
303
desktop3
collection3
033
313
clone3
build3
wedding3
vol33
vol13
adware3

What are the nameservers for mac-torrent-download.net?

Mac-torrent-download.net Domain Nameserver Information

HostIP AddressCountry
clay.ns.cloudflare.com 173.245.59.88United States United States
ruth.ns.cloudflare.com 173.245.58.143United States United States

Mac-torrent-download.net Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Mac-torrent-download.net is a scam?