Manpowerconsultant.in  |  G. Gheewala - Human Resources Consultants for Gulf, Middle East, Saudi Arabia, Dubai
Low trust score  | 
G. Gheewala - Manpower Consultants for overseas appointments in Computers, Outsourcing, Liaison Office, Outsource, Offshore, Customer Relation Management, Medical Transcription, Engineering, Oil fields & Elevators industry, Gulf, Middle East

jobs in saudi arabia, jobs in middle east, jobs in dubai, jobs in qatar, jobs in kuwait, jobs in uae, jobs in yeman, jobs in oman, manpower india, recruitment consultant, india manpower, manpower consultant india, manpower consultant mumbai, india placement agency, recruitment companies india, recruitment companies mumbai, indian manpower, manpower mumbai, india employment agency, india jobs, jobs mumbai, jobs india, employment agencies india, employment agency mumbai, it staff mumbai, it jobs mumbai, mumbai recruitment company, india recruitment company, manpower search company india, elevator manpower, lift manpower, elevator manpower supply, employment services mumbai, employment services india, employment service, professional manpower consultants, human resources, hr services, job vacancy, recruitment, job hunter, manpower consultant, office space in mumbai, conference room, lifts, elevators, escalators, it services, information technology india, it manpower india, it manpower mumbai, head hunter mumbai, head hunting india, head hunting companies mumbai, head hunting companies india, setting up office in india, setting up office in mumbai, staring office in india, starting office in mumbai, cv india, cv mumbai, bio data mumbai, hot jobs, mumbai hr consultants, gheewala, ggheewala, g gheewala, zobia designs, zobia design agency, zobia, altaf husain, zobia altaf, web site development, web services, web design, web designers, india, mumbai, web developer, web site design, web site designer, web site developer, live webcasting, webcasting, live streaming, e commerce consulting, e commerce developer, e commerce web design, business to business, web site builder, online marketing, web marketing, online advertising, search engine promotion, search engine optimization, internet marketing, web evaluation, web consulting, e media, planning, placement, java, programming, offshore, sql, cold fusion, database, oracle, microsoft, unix, outsourcing, outsource, html, xml, visual basic, animation, streaming, webcast, digital webcast, webcast provider, webcast services, webcast captioning, live broadcasting, live broadcasting on internet, satellite transmission, streaming video, audio, flash, macromedia, opt in email, contact management, viral marketing, webdesign, consultation, web agency, website  Show all keywords

Manpowerconsultant.in Website Information

Manpowerconsultant.in has a Low Trust Score, a Statvoo Rank of G, an Alexa Rank of 415,832, a Majestic Rank of 0, a Domain Authority of 30% and is not listed in DMOZ.

Manpowerconsultant.in is hosted by SoftLayer Technologies Inc. in Texas, Houston, United States, 77002.
Manpowerconsultant.in has an IP Address of 173.193.106.14 and a hostname of e.6a.c1ad.ip4.static.sl-reverse.com.

The domain manpowerconsultant.in was registered 1 decade 1 year 10 months ago by , it was last modified 5 years 6 months 1 week ago and currently is set to expire 10 months 3 weeks 4 days ago.


Whois information for manpowerconsultant.in

Full Whois Lookup for Manpowerconsultant.in Whois Lookup

Access to .IN WHOIS information is provided to assist persons in determining the contents of a domain name registration record in the .IN registry database. The data in this record is provided by .IN Registry for informational purposes only, and .IN does not guarantee its accuracy. This service is intended only for query-based access. You agree that you will use this data only for lawful purposes and that, under no circumstances will you use this data to: (a) allow, enable, or otherwise support the transmission by e-mail, telephone, or facsimile of mass unsolicited, commercial advertising or solicitations to entities other than the data recipient's own existing customers; or (b) enable high volume, automated, electronic processes that send queries or data to the systems of Registry Operator, a Registrar, or Afilias except as reasonably necessary to register domain names or modify existing registrations. All rights reserved. .IN reserves the right to modify these terms at any time. By submitting this query, you agree to abide by this policy.

Domain ID:D2639424-AFIN
Domain Name:MANPOWERCONSULTANT.IN
Created On:17-Oct-2007 17:41:50 UTC
Last Updated On:25-Feb-2014 06:54:51 UTC
Expiration Date:17-Oct-2018 17:41:50 UTC
Sponsoring Registrar:Endurance Domains Technology LLP (R173-AFIN)
Status:CLIENT TRANSFER PROHIBITED
Reason:
Registrant ID:WIQ_32668438
Registrant Name:GGTC
Registrant Organization:GG -TC
Registrant Street1:Mumbai
Registrant Street2:
Registrant Street3:
Registrant City:Mumbai
Registrant State/Province:Maharashtra
Registrant Postal Code:400007
Registrant Country:IN
Registrant Phone:+91.9223363301
Registrant Phone Ext.:
Registrant FAX:
Registrant FAX Ext.:
Registrant Login to show email
ID:WIQ_32668438
Admin Name:GGTC
Admin Organization:GG -TC
Admin Street1:Mumbai
Admin Street2:
Admin Street3:
Admin City:Mumbai
Admin State/Province:Maharashtra
Admin Postal Code:400007
Admin Country:IN
Admin Phone:+91.9223363301
Admin Phone Ext.:
Admin FAX:
Admin FAX Ext.:
Admin Login to show email
ID:WIQ_32668438
Tech Name:GGTC
Tech Organization:GG -TC
Tech Street1:Mumbai
Tech Street2:
Tech Street3:
Tech City:Mumbai
Tech State/Province:Maharashtra
Tech Postal Code:400007
Tech Country:IN
Tech Phone:+91.9223363301
Tech Phone Ext.:
Tech FAX:
Tech FAX Ext.:
Tech Login to show email
Server:56621.MERCURY.ORDERBOX-DNS.COM
Name Server:56621.VENUS.ORDERBOX-DNS.COM
Name Server:56621.EARTH.ORDERBOX-DNS.COM
Name Server:56621.MARS.ORDERBOX-DNS.COM
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
DNSSEC:Unsigned

Who hosts Manpowerconsultant.in?

Manpowerconsultant.in Web Server Information

Hosted IP Address:173.193.106.14
Hosted Hostname:e.6a.c1ad.ip4.static.sl-reverse.com
Service Provider:SoftLayer Technologies Inc.
Hosted Country:United StatesUS
Location Latitude:29.7702
Location Longitude:-95.3628
Webserver Software:Not Applicable

HTTP Header Analysis for Manpowerconsultant.in

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Cache-Control: private
Content-Type: text/html
Content-Encoding: gzip
Vary: Accept-Encoding
Server: Microsoft-IIS/7.5
X-Powered-By: ASP.NET
X-Powered-By-Plesk: PleskWin
Date: Wed, 16 Sep 2015 14:13:11 GMT
Content-Length: 11950


Need to find out who hosts Manpowerconsultant.in?

Manpowerconsultant.in Free SEO Report

Website Inpage Analysis for Manpowerconsultant.in

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Manpowerconsultant.in

jobgassaudimopeningsseekersmaadenggheewalafunctioncompanyjob seekersindustryleadingg gheewalaoilcorporateallclientsourusjobs0ampnbsppetrochemicalqatar

Longtail Keyword Density for Manpowerconsultant.in

KeywordsOccurences
g gheewala5
job seekers3
jobs8
g7
us5
company5
gheewala5
job5
qatar4
leading4
m4
industry4
our4
amp3
all3
function3
corporate3
saudi3
maaden3
openings3
seekers3
petrochemical3
oil3
03
nbsp3
gas3
clients3

What are the nameservers for manpowerconsultant.in?


Manpowerconsultant.in Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Manpowerconsultant.in is a scam?