Hotels & Resorts | Buchen Sie Ihr Hotel direkt bei Marriott Bonvoy

Safety: Low trust score
Year Founded: 0000
Global Traffic Rank: 71,720
Estimated Worth: $109,800

Entdecken Sie das Hotelportfolio von Marriott International und erfahren Sie, was jede Marke einzigartig macht. Hier direkt Ihr Hotel reservieren und stressfrei reisen!



Domain summary

Last updated
2021-03-09
Domain label
marriott
Domain extension
de
Global Traffic Rank
71,720
Statvoo Rating
E
Trust Score
Low Trust Score
Estimated worth
$109,800
Estimated daily income
$183
Estimated monthly income
$5,566

Rank summary

How is marriott.de ranked relative to other sites:

Percentage of visits to marriott.de from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Marriott.de registered?
A: Marriott.de was registered 2021 years, 4 months, 3 weeks, 1 day, 23 hours, 41 minutes, 12 seconds ago on Monday, November 30, -0001.
Q: When was the WHOIS for Marriott.de last updated?
A: The WHOIS entry was last updated 8 years, 5 months, 4 weeks, 1 day, 23 hours, 41 minutes, 12 seconds ago on Wednesday, October 24, 2012.
Q: What are Marriott.de's nameservers?
A: DNS for Marriott.de is provided by the following nameservers:
  • eur1.akam.net
  • ns1-22.akam.net
  • ns1-7.akam.net
Q: Who is the registrar for the Marriott.de domain?
A: The domain has been registered at .
Q: What is the traffic rank for Marriott.de?
A: Marriott.de ranks 71,720 globally on Alexa. Marriott.de has a Low Trust Score, and a Statvoo Rank of E.
Q: How many people visit Marriott.de each day?
A: Marriott.de receives approximately 14,645 visitors and 73,225 page impressions per day.
Q: What IP address does Marriott.de resolve to?
A: Marriott.de resolves to the IPv4 address 23.63.99.242.
Q: In what country are Marriott.de servers located in?
A: Marriott.de has servers located in the Netherlands.
Q: What webserver software does Marriott.de use?
A: Marriott.de is powered by IBM_HTTP_Server/8.0.0.5 (Unix) webserver.
Q: Who hosts Marriott.de?
A: Marriott.de is hosted by Akamai International B.V. in North Holland, Amsterdam, Netherlands, 1091.
Q: How much is Marriott.de worth?
A: Marriott.de has an estimated worth of $109,800. An average daily income of approximately $183, which is roughly $5,566 per month.

Marriott.de Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Marriott.de Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Marriott.de

H1 Headings

2 :
  1. ENTDECKEN SIE UNSERE MARKEN
  2. Bestpreisgarantie auf Marriott.de

H2 Headings

6 :
  1. Wohin möchten Sie reisen?
  2. Marriott Bonvoy™ Mitgliedertarife. Unser Bestpreis. Jederzeit.
  3. Die besten Angebote dieser Woche
  4. Top-Reiseziele
  5. Für Gäste
  6. Unser Unternehmen

H3 Headings

3 :
  1. Marriott Bonvoy
  2. Tagungen und Veranstaltungen
  3. Angebote und Pakete

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

7 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

70:

Links - Internal (nofollow)

0:

Links - Outbound

38:

Links - Outbound (nofollow)

0:

Keyword Cloud for Marriott.de

false textalign left3 4 5gxe4ste 16 7boxshadowctacolwidth false newwindow1 2 3sie52 3typesadtimageadtarticleadtmessageadtlinkadtcontactusadtmembershipadtpartnerprogramkeynamecardheadlineaspectrationavigationtruenavigationfilterssortszimmeralterclose contents4 5leftnewwindow falsecontents typesadtlinkmaxnumrecords20navigationfalsehotelspecifictrueroomspecificobjecttypesadtimageadtarticleadtmessageadtlinkadtcontactusadtmembershipadtpartnerprogramkeynamecarddraweraspectrationavigationtruenavigationfilterssorts boxshadow7falsetextcolornohorizontalpaddingtypesadtimageadtarticleadtmessageadtlinkadtcontactusadtmembershipadtpartnerprogramkeynamecarddraweraspectrationavigationtruenavigationfilterssorts boxshadow false2 3 45 6textalign left4false textaligncontents typesadtimageadtarticleadtmessageadtlinkadtcontactusadtmembershipadtpartnerprogramkeynamecardheadlineaspectrationavigationtruenavigationfilterssortsgxe4stelinkmirrorview falsenohorizontalpadding false textemphasisnewwindow false mirrorviewnewwindowcolorcodeboxshadow falseanzahl der kinderxdcbernachtungenfalse mirrorview falsetypesadtlinkmaxnumrecords20navigationfalsehotelspecifictrueroomspecificobjectfalse mirrorviewmarriottfalse textemphasisobjectnavigationfilterssorts8dersuchen3 4false textemphasis falseanmeldenmirrorview false textalignclosectacolwidth falsezimmer 1contentstextemphasis false colorcodeleft nohorizontalpaddinganzahl derabbrechen0false colorcodetextcolor contents typesadtimageadtarticleadtmessageadtlinkadtcontactusadtmembershipadtpartnerprogramkeynamecardheadlineaspectrationavigationtruenavigationfilterssortsleft nohorizontalpadding false1anzahlboxshadow false ctatypefalse newwindow6 7 82odertextalign left nohorizontalpaddingclose contents typesadtlinkmaxnumrecords20navigationfalsehotelspecifictrueroomspecificobjectcontents typesadtlinkmaxnumrecords50navigationfalsehotelspecifictrueroomspecificobjecttextemphasis falsetextemphasisdie1 26typesadtimageadtarticleadtmessageadtlinkadtcontactusadtmembershipadtpartnerprogramkeynamecarddraweraspectrationavigationtruenavigationfilterssortsfalse newwindow falsectatypedatentextalignfalse ctatypetypesadtlinkmaxnumrecords50navigationfalsehotelspecifictrueroomspecificobject3kindertextcolor contentsder kinder4 5 6typesadtarticlemaxnumrecords10navigationfalsehotelspecificobjectnohorizontalpadding falsefalse colorcode closetextcolor contents typesadtlinkmaxnumrecords50navigationfalsehotelspecifictrueroomspecificobjectmirrorviewctacolwidth5 6 7colorcode close7 8

Longtail Keyword Density for Marriott.de

KeywordsOccurences
typesadtimageadtarticleadtmessageadtlinkadtcontactusadtmembershipadtpartnerprogramkeynamecard-draweraspectrationavigationtruenavigationfilterssorts boxshadow false5
boxshadow false ctatype5
ctacolwidth false newwindow5
false newwindow false5
nohorizontalpadding false textemphasis5
false textemphasis false5
textemphasis false colorcode5
5 6 74
4 5 64
3 4 54
2 3 44
1 2 34
anzahl der kinder4
close contents typesadtlinkmaxnumrecords20navigationfalsehotelspecifictrueroomspecificobject4
textcolor contents typesadtlinkmaxnumrecords50navigationfalsehotelspecifictrueroomspecificobject4
left nohorizontalpadding false4
textalign left nohorizontalpadding4
false textalign left4
newwindow false mirrorview3
false mirrorview false3
mirrorview false textalign3
false colorcode close3
6 7 83
textcolor contents typesadtimageadtarticleadtmessageadtlinkadtcontactusadtmembershipadtpartnerprogramkeynamecard-headlineaspectrationavigationtruenavigationfilterssorts3
contents typesadtlinkmaxnumrecords20navigationfalsehotelspecifictrueroomspecificobject10
contents typesadtlinkmaxnumrecords50navigationfalsehotelspecifictrueroomspecificobject8
textcolor contents7
anzahl der6
typesadtimageadtarticleadtmessageadtlinkadtcontactusadtmembershipadtpartnerprogramkeynamecard-draweraspectrationavigationtruenavigationfilterssorts boxshadow5
false textemphasis5
boxshadow false5
false colorcode5
textemphasis false5
close contents5
nohorizontalpadding false5
false ctatype5
false textalign5
newwindow false5
false newwindow5
ctacolwidth false5
2 34
6 74
5 64
4 54
3 44
1 24
textalign left4
left nohorizontalpadding4
der kinder4
colorcode close3
mirrorview false3
false mirrorview3
contents typesadtimageadtarticleadtmessageadtlinkadtcontactusadtmembershipadtpartnerprogramkeynamecard-headlineaspectrationavigationtruenavigationfilterssorts3
7 83
gxe4ste 13
zimmer 13
false32
contents30
textcolor27
013
typesadtlinkmaxnumrecords20navigationfalsehotelspecifictrueroomspecificobject10
zimmer9
typesadtlinkmaxnumrecords50navigationfalsehotelspecifictrueroomspecificobject8
anzahl8
16
textalign6
close6
der6
ctatype5
25
35
typesadtimageadtarticleadtmessageadtlinkadtcontactusadtmembershipadtpartnerprogramkeynamecard-draweraspectrationavigationtruenavigationfilterssorts5
kinder5
typesadtarticlemaxnumrecords10navigationfalsehotelspecificobject5
boxshadow5
colorcode5
textemphasis5
nohorizontalpadding5
left5
newwindow5
ctacolwidth5
44
54
64
oder4
abbrechen4
sie4
74
gxe4ste3
83
alter3
mirrorview3
xdcbernachtungen3
daten3
objectnavigationfilterssorts3
typesadtimageadtarticleadtmessageadtlinkadtcontactusadtmembershipadtpartnerprogramkeynamecard-headlineaspectrationavigationtruenavigationfilterssorts3
suchen3
anmelden3
marriott3
link3
die3

Who hosts Marriott.de?

Marriott.de Hosting Provider Information

Hosted IP Address:23.63.99.242
Hosted Hostname:a23-63-99-242.deploy.static.akamaitechnologie
Service Provider:Akamai International B.V.
Hosted Country:NetherlandsNL
Location Latitude:52.35
Location Longitude:4.9167
Webserver Software:IBM_HTTP_Server/8.0.0.5 (Unix)

Is "Akamai International B.V." in the Top 10 Hosting Companies?

Name
Percentage
DoD Network Information Center
16.7387%
GoDaddy.com, LLC
8.5968%
Namecheap, Inc.
4.2653%
Confluence Networks Inc
2.7791%
Google Inc.
2.3954%
Merit Network Inc.
1.8799%
Fara Negar Pardaz Khuzestan
1.8361%
1&1 Internet AG
1.8274%
Amazon.com, Inc.
1.7814%
Cogent Communications
1.6096%
Akamai International B.V.
0.0071%

HTTP Header Analysis for Marriott.de

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx
Content-Type: text/html; charset=utf-8
Vary: Accept-Encoding
X-Request-Id: /default.mi~X~0BE4F6B9-C165-5E29-B9EE-FB0F48CC4EF7
X-Service-Id: ram-nginx-auto-57-mdttd
Link:; as=script; rel=preload,; as=script; rel=preload,; as=script; rel=preload,; as=script; rel=preload,; as=script; rel=preload,; as=script; rel=preload,; as=script; rel=preload,; as=script; rel=preload,; as=script; rel=preload,; as=script; rel=preload,; as=script; rel=preload,; as=script; rel=preload,; as=script; rel=preload,; as=script; rel=preload,; as=script; rel=preload,; as=script; rel=preload,; as=script; rel=preload,; as=script; rel=preload,; as=script; rel=preload,; as=script; rel=preload,; as=script; rel=preload,; as=script; rel=preload,; as=script; rel=preload,; as=script; rel=preload,; as=script; rel=preload,; as=script; rel=preload,; as=script; rel=preload
X-dynaTrace: PT=8061912;PA=1697006965;SP=Marriott.com Production;PS=-659768705
X-XSS-Protection: 1; mode=block
Content-Encoding: gzip
X-Akamai-Transformed: 9 40575 0 pmb=mNONE,1mTOE,4
Expires: Tue, 09 Mar 2021 07:52:01 GMT
Cache-Control: max-age=0, no-cache, no-store
Pragma: no-cache
Date: Tue, 09 Mar 2021 07:52:01 GMT
Content-Length: 33282
Connection: keep-alive
Retry-After: 28800
Strict-Transport-Security: max-age=86400 ; includeSubDomains

Marriott.de Domain Nameserver Information

HostIP AddressCountry
eur1.akam.net 2.16.130.64
ns1-22.akam.net 193.108.91.22
ns1-7.akam.net 193.108.91.7


Need to find out who hosts Marriott.de?


Domain Registration (WhoIs) information for Marriott.de

 % Restricted rights.
%
% Terms and Conditions of Use
%
% The above data may only be used within the scope of technical or
% administrative necessities of Internet operation or to remedy legal
% problems.
% The use for other purposes, in particular for advertising, is not permitted.
%
% The DENIC whois service on port 43 doesn't disclose any information concerning
% the domain holder, general request and abuse contact.
% This information can be obtained through use of our web-based whois service
% available at the DENIC website:
% http://www.denic.de/en/domains/whois-service/web-whois.html
%
%

Domain: marriott.de
Nserver: eur1.akam.net
Nserver: ns1-22.akam.net
Nserver: ns1-7.akam.net
Status: connect
Changed: 2012-10-24T19:45:11+02:00

Websites with Similar Names

Marri-rc.org
marri-rc.org – My WordPress Blog
Marri.com.br
Marri Móveis
Marri.dev
Jamal Marri
Marri.us
MARRI Research
Marri2021.com
#Marri2021 — Secure
Marriagaasesoresyconsultores.com
Home - Marriaga Asesores y Consultores

Recently Updated Websites

Meaningful360.com (1 second ago.)Ajans.best (3 seconds ago.)Breanajelks.com (4 seconds ago.)Criptoviaje.com (4 seconds ago.)Qp195.app (4 seconds ago.)8886812.com (5 seconds ago.)Zetteharbourcoach.com (6 seconds ago.)Comn.world (7 seconds ago.)Completecarecounseling.com (7 seconds ago.)Kxrides.com (7 seconds ago.)Lexmiles.com (7 seconds ago.)Stratoservice.com (7 seconds ago.)Pixnet.net (7 seconds ago.)Bluechewtab.com (8 seconds ago.)Shadybanks.net (8 seconds ago.)Letsdefeatdepression.com (9 seconds ago.)Juanpadro.com (10 seconds ago.)Bondagedesigns.com (10 seconds ago.)Mariettatimes.com (10 seconds ago.)Transcend10.net (11 seconds ago.)Josettelachevre.ovh (12 seconds ago.)Centech.ma (12 seconds ago.)Lanatigrana.ru (13 seconds ago.)Surefibre.net (13 seconds ago.)Hsinchunchou.com (14 seconds ago.)Travelsbeyondborders.com (15 seconds ago.)Seat.vip (15 seconds ago.)Online-bible.org.uk (15 seconds ago.)Poaa.nl (19 seconds ago.)Diabestiv.com (19 seconds ago.)

Recently Searched Keywords

proje koordinatr724 (2 seconds ago.)bile (2 seconds ago.)pramonės asociacija: beveik dviem šimtams europos oro uostų gresia bankrotas (3 seconds ago.)nibbled (5 seconds ago.)himom (7 seconds ago.)headphone babies (9 seconds ago.)bonos de apuestas (11 seconds ago.)wall hangings (11 seconds ago.)для тебя, бессмертный ~ (20:00) (12 seconds ago.)пружина ударника crosman 1377 (известного также как крыс). псп. рср. изготовление пружин. изготовить пружины (14 seconds ago.)rp-background-gradientbackgroundlinear-gradient0deg rgb000 0 (14 seconds ago.)bhopal (15 seconds ago.)heat treatment services (16 seconds ago.)0 retweet 4 (16 seconds ago.)none width (17 seconds ago.)owl-featured-categories (17 seconds ago.)уровниот 7 р. 00 к. (18 seconds ago.)europcar sydney (20 seconds ago.)2020 0700 (23 seconds ago.)14 dec 2015 (23 seconds ago.)cards (24 seconds ago.)shins meaning (25 seconds ago.)br882021 (26 seconds ago.)185 159 100 (26 seconds ago.)wrd (27 seconds ago.)buyessayonline.org review (29 seconds ago.)grand caravan (33 seconds ago.)top parseintscreenavailheight 2 (33 seconds ago.)hd 9 min brunette teen with porn brunette glasses (34 seconds ago.)diego california our (35 seconds ago.)