Matronics - Ekspert i LED produkter og elektronik til belysning

Safety: Low trust score
Year Founded: 2020
Global Traffic Rank: Unknown
Estimated Worth: $9
Last updated:2020-10-19
Category: This site has not been categorized yet

Matronics.dk er specialist i LED lys til alle formål. LED belysning til privat og erhverv, bil, lastbil og MC. Deribandt LED pærer, projektører, arbejdslamper og special produkter.


Domain summary

Domain label
matronics
Domain extension
dk
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is matronics.dk ranked relative to other sites:

Percentage of visits to matronics.dk from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Matronics.dk registered?
A: Matronics.dk was registered 3 months, 22 hours, 20 minutes, 3 seconds ago on Monday, October 19, 2020.
Q: When was the WHOIS for Matronics.dk last updated?
A: The WHOIS entry was last updated 3 months, 22 hours, 20 minutes, 3 seconds ago on Monday, October 19, 2020.
Q: What are Matronics.dk's nameservers?
A: DNS for Matronics.dk is provided by the following nameservers:
  • ns2.simply.com
  • ns1.simply.com
  • ns3.simply.com
  • ns4.simply.com
Q: Who is the registrar for the Matronics.dk domain?
A: The domain has been registered at .
Q: What is the traffic rank for Matronics.dk?
A: Matronics.dk has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Matronics.dk each day?
A: Matronics.dk receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Matronics.dk resolve to?
A: Matronics.dk resolves to the IPv4 address 92.51.183.9.
Q: In what country are Matronics.dk servers located in?
A: Matronics.dk has servers located in the Germany.
Q: What webserver software does Matronics.dk use?
A: Matronics.dk is powered by Microsoft-IIS/7.5 webserver.
Q: Who hosts Matronics.dk?
A: Matronics.dk is hosted by Host Europe GmbH in North Rhine-westphalia, Germany.
Q: How much is Matronics.dk worth?
A: Matronics.dk has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Matronics.dk Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Matronics.dk Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Matronics.dk

H1 Headings

1 :
  1. Ekspert i LED produkter og elektronik til belysning

H2 Headings

10 :
  1. Produkt-udvikling, sourcing og services
  2. Nyhedsbrev
  3. Sikkert køb - hver gang
  4. Perfekte anmeldelser
  5. Hjælp & vejledning?
  6. Nyhedsbrev
  7. Besøg os i butikken
  8. Matronics videoer
  9. Matronics Facebook
  10. Trustpilot anmeldelser

H3 Headings

3 :
  1. Tilmeld nyhedsbrev
  2. Afmeld
  3. er nu lagt i kurven

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

18 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-1831894-4

Links - Internal

42:

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Matronics.dk

tilmeldp20px 8pxkontaktvoresledandrekurvenmatronicsreviewsbottomtilbudmed20pxreviewsekananmeldelserpaddinglastbilcenterreviews8pxer0biltrustpilotduaddedtobasketmodalbelysning0pxmcelektronikpadding 0px 20pxnyhedsbrevamp0px 20px 8pxvores nyhedsbrevfacebookoggadgetsquotesharpadding 0pxservicesalleafprodukteretostil0px 20pxom

Who hosts Matronics.dk?

Matronics.dk Hosting Provider Information

Hosted IP Address:92.51.183.9
Hosted Hostname:ds92-51-183-9.dedicated.hosteurope.de
Service Provider:Host Europe GmbH
Hosted Country:GermanyDE
Location Latitude:51.4476
Location Longitude:7.0122
Webserver Software:Microsoft-IIS/7.5

Is "Host Europe GmbH" in the Top 10 Hosting Companies?

Name
Percentage
GoDaddy.com, LLC
9.5100%
DoD Network Information Center
8.4509%
Google Inc.
2.8338%
Confluence Networks Inc
2.6217%
Amazon.com, Inc.
2.1737%
Namecheap, Inc.
2.1384%
TOT Public Company Limited
1.5665%
1&1 Internet AG
1.5512%
Merit Network Inc.
1.3856%
Unified Layer
1.3043%
Host Europe GmbH
0.0864%

HTTP Header Analysis for Matronics.dk

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Cache-Control: private
Content-Type: text/html; charset=utf-8
Content-Encoding: gzip
Vary: Accept-Encoding
Server: Microsoft-IIS/7.5
X-AspNetMvc-Version: 5.2
X-AspNet-Version: 4.0.30319
X-Powered-By: ASP.NET
Access-Control-Allow-Origin: *
Date: Mon, 19 Oct 2020 17:51:29 GMT
Content-Length: 9014

Matronics.dk Domain Nameserver Information

HostIP AddressCountry
ns2.simply.com 185.25.141.15
ns1.simply.com 46.36.215.2
ns3.simply.com 83.217.78.186
ns4.simply.com 85.159.211.233


Need to find out who hosts Matronics.dk?


Domain Registration (WhoIs) information for Matronics.dk

Websites with Similar Names

Matro-roll.top
matro-roll.top - Hosting.UA
Matro.be
Matro Truck Accessories Wesbhop
Matro2020.com
Matro 2020 | My WordPress Blog
Matrockin.ru
Интернет-магазин «Матроскин» — Товары для дома, дачи, сада и огорода, для автомобилистов, спорта и активного отдыха.
Matrocome.club
matrocome.club - Registered at Namecheap.com
Matroda.com
Database Error

Recently Updated Websites

Khs.care (2 seconds ago.)Cdh.capital (2 seconds ago.)Hotnewcarsale.website (3 seconds ago.)Sichere-gastfreundschaft.bayern (3 seconds ago.)Supernewcarprice.website (4 seconds ago.)Hostyle.biz (4 seconds ago.)Andiranicole.blog (4 seconds ago.)Minglesportsbar.biz (4 seconds ago.)Divinelady.boutique (5 seconds ago.)Lecriasacam.website (5 seconds ago.)Consultoraalzirafazenda.website (5 seconds ago.)Ccerfjfvya.cam (6 seconds ago.)Appsdailybzrr43387.buzz (6 seconds ago.)Soccer.photos (7 seconds ago.)Investingrealestate.biz (7 seconds ago.)Gvxtxhqkt.cam (7 seconds ago.)Thetruezen.blog (7 seconds ago.)Sgtsv.army (8 seconds ago.)Cryptoc.art (8 seconds ago.)Gramguarniepreas.website (8 seconds ago.)Pokercash.work (8 seconds ago.)Joinmy.art (8 seconds ago.)Siocramorlin.website (9 seconds ago.)Fransjacobs.art (10 seconds ago.)Cerfjfvyd.cam (10 seconds ago.)Galaxyweb.work (10 seconds ago.)Philosophy.camp (10 seconds ago.)Fosmeroti.website (10 seconds ago.)Localtoglobal.biz (10 seconds ago.)Consultnow.app (11 seconds ago.)

Recently Searched Keywords

ataky masz escort (2 seconds ago.)immunity booster herbs (3 seconds ago.)wolstar (4 seconds ago.)дивитися далі (5 seconds ago.)surprisingact (7 seconds ago.)immunity booster in ayurveda (7 seconds ago.)totachi niro hd semi-synthetic 10 (10 seconds ago.)immunity booster supplements (10 seconds ago.)u0440u0443u043a u00abu041au043eu043du043eu043fu043bu044fu043du043eu0435 (12 seconds ago.)азбука танца и танцевальные движения для дошкольников.  (12 seconds ago.)aloe vera juice (15 seconds ago.)мнение. монополизация мирового агропрома приняла угрожающие размеры (15 seconds ago.)psa psa (18 seconds ago.)le blog (18 seconds ago.)immunity booster juice (18 seconds ago.)calliope (19 seconds ago.)under $50 (19 seconds ago.)ishop layout (22 seconds ago.)check it out john mellencamp (22 seconds ago.)immunity booster drink (22 seconds ago.)kinara contctanos (22 seconds ago.)мнение. монополизация мирового агропрома приняла угрожающие размеры (23 seconds ago.)800 100vw 1600 (23 seconds ago.)green chemistry (23 seconds ago.)news 1 min (24 seconds ago.)amp ilustraciones (24 seconds ago.)immunity booster (26 seconds ago.)test methods (26 seconds ago.)etpbslide6etpbslide etpbslidedescription (27 seconds ago.)corset costumes (27 seconds ago.)